BLASTX nr result
ID: Atractylodes21_contig00004993
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00004993 (643 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627749.1| hypothetical protein MTR_8g037800 [Medicago ... 64 2e-08 ref|XP_002283641.1| PREDICTED: uncharacterized protein LOC100245... 60 3e-07 ref|NP_001236665.1| uncharacterized protein LOC100500603 precurs... 60 3e-07 emb|CAN82852.1| hypothetical protein VITISV_041720 [Vitis vinifera] 59 6e-07 ref|XP_002313779.1| predicted protein [Populus trichocarpa] gi|2... 58 1e-06 >ref|XP_003627749.1| hypothetical protein MTR_8g037800 [Medicago truncatula] gi|355521771|gb|AET02225.1| hypothetical protein MTR_8g037800 [Medicago truncatula] gi|388492214|gb|AFK34173.1| unknown [Medicago truncatula] Length = 91 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +2 Query: 233 IHERLLRVNTKDYGRSDPAPTFVKPPFKLIPN 328 IHERLLR NTKDYGR DP+PTF KPPFKLIPN Sbjct: 60 IHERLLRANTKDYGRYDPSPTFSKPPFKLIPN 91 >ref|XP_002283641.1| PREDICTED: uncharacterized protein LOC100245294 [Vitis vinifera] gi|297744426|emb|CBI37688.3| unnamed protein product [Vitis vinifera] Length = 95 Score = 60.5 bits (145), Expect = 3e-07 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = +2 Query: 212 QISKREEIHERLLRVNTKDYGRSDPAPTFVKPPFKLIPN 328 Q + E IHERLLR NT+DYG DPAP KPPFKLIPN Sbjct: 57 QYRRAEAIHERLLRANTRDYGNYDPAPALGKPPFKLIPN 95 >ref|NP_001236665.1| uncharacterized protein LOC100500603 precursor [Glycine max] gi|255630736|gb|ACU15729.1| unknown [Glycine max] Length = 93 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +2 Query: 233 IHERLLRVNTKDYGRSDPAPTFVKPPFKLIPN 328 IHERLLR NTKDYGR DP+P+ KPPFKLIPN Sbjct: 62 IHERLLRANTKDYGRYDPSPSLSKPPFKLIPN 93 >emb|CAN82852.1| hypothetical protein VITISV_041720 [Vitis vinifera] Length = 249 Score = 59.3 bits (142), Expect = 6e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +2 Query: 221 KREEIHERLLRVNTKDYGRSDPAPTFVKPPFKLIPN 328 + E IHERLLR NT+DYG DPAP KPPFKLIPN Sbjct: 214 RAEAIHERLLRANTRDYGNYDPAPALGKPPFKLIPN 249 >ref|XP_002313779.1| predicted protein [Populus trichocarpa] gi|222850187|gb|EEE87734.1| predicted protein [Populus trichocarpa] Length = 94 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = +2 Query: 188 ESLYSEDDQISKREEIHERLLRVNTKDYGRSDPAPTFVKPPFKLIPN 328 E + S+ ++ IHERLL+ NTKDYG PAP V+PPFKLIPN Sbjct: 48 EEISSKPSHNNEATTIHERLLKANTKDYGNYKPAPALVRPPFKLIPN 94