BLASTX nr result
ID: Atractylodes21_contig00004557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00004557 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_567922.2| aspartyl protease family protein [Arabidopsis t... 67 2e-09 dbj|BAC43357.1| putative nucellin [Arabidopsis thaliana] 67 2e-09 ref|XP_002867175.1| hypothetical protein ARALYDRAFT_328390 [Arab... 67 2e-09 ref|NP_001190905.1| aspartyl protease family protein [Arabidopsi... 67 2e-09 emb|CAB38807.1| nucellin-like protein [Arabidopsis thaliana] gi|... 67 2e-09 >ref|NP_567922.2| aspartyl protease family protein [Arabidopsis thaliana] gi|332660833|gb|AEE86233.1| aspartyl protease family protein [Arabidopsis thaliana] Length = 401 Score = 66.6 bits (161), Expect = 2e-09 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 274 YYHVTVNIVNPPQP*WLDIDTGSDLTWLQCGAPCTKC 164 YY+VT+NI PP+P +LD+DTGSDLTWLQC APC +C Sbjct: 56 YYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRC 92 >dbj|BAC43357.1| putative nucellin [Arabidopsis thaliana] Length = 413 Score = 66.6 bits (161), Expect = 2e-09 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 274 YYHVTVNIVNPPQP*WLDIDTGSDLTWLQCGAPCTKC 164 YY+VT+NI PP+P +LD+DTGSDLTWLQC APC +C Sbjct: 47 YYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRC 83 >ref|XP_002867175.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. lyrata] gi|297313011|gb|EFH43434.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. lyrata] Length = 425 Score = 66.6 bits (161), Expect = 2e-09 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 274 YYHVTVNIVNPPQP*WLDIDTGSDLTWLQCGAPCTKC 164 YY+VT+NI PP+P +LD+DTGSDLTWLQC APC +C Sbjct: 59 YYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRC 95 >ref|NP_001190905.1| aspartyl protease family protein [Arabidopsis thaliana] gi|21592493|gb|AAM64443.1| nucellin-like protein [Arabidopsis thaliana] gi|332660834|gb|AEE86234.1| aspartyl protease family protein [Arabidopsis thaliana] Length = 425 Score = 66.6 bits (161), Expect = 2e-09 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 274 YYHVTVNIVNPPQP*WLDIDTGSDLTWLQCGAPCTKC 164 YY+VT+NI PP+P +LD+DTGSDLTWLQC APC +C Sbjct: 59 YYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRC 95 >emb|CAB38807.1| nucellin-like protein [Arabidopsis thaliana] gi|7270297|emb|CAB80066.1| nucellin-like protein [Arabidopsis thaliana] Length = 420 Score = 66.6 bits (161), Expect = 2e-09 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 274 YYHVTVNIVNPPQP*WLDIDTGSDLTWLQCGAPCTKC 164 YY+VT+NI PP+P +LD+DTGSDLTWLQC APC +C Sbjct: 37 YYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRC 73