BLASTX nr result
ID: Atractylodes21_contig00004485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00004485 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA38277.1| TPA: hypothetical protein ZEAMMB73_017117 [Zea m... 55 6e-06 ref|XP_002447622.1| hypothetical protein SORBIDRAFT_06g009000 [S... 55 6e-06 >tpg|DAA38277.1| TPA: hypothetical protein ZEAMMB73_017117 [Zea mays] Length = 487 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 3 AIEASPITIGERNVVVEEKRSTNSKGGNR-GRFVAGRGPGF 122 AIEASP+TIGER VEEKR+T S+GG+R GRF GRG F Sbjct: 376 AIEASPVTIGERQCFVEEKRTTGSRGGSRGGRFPPGRGGNF 416 >ref|XP_002447622.1| hypothetical protein SORBIDRAFT_06g009000 [Sorghum bicolor] gi|241938805|gb|EES11950.1| hypothetical protein SORBIDRAFT_06g009000 [Sorghum bicolor] Length = 493 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = +3 Query: 3 AIEASPITIGERNVVVEEKRSTNSKGGNR-GRFVAGRGPGF 122 AIEASP+TIGER VEEKR+T S+GG+R GRF GRG F Sbjct: 383 AIEASPVTIGERQCYVEEKRTTGSRGGSRGGRFSPGRGGNF 423