BLASTX nr result
ID: Atractylodes21_contig00004467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00004467 (727 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK38398.1| unknown [Medicago truncatula] 68 2e-09 gb|AFW67871.1| putative RING zinc finger domain superfamily prot... 67 3e-09 ref|XP_003560736.1| PREDICTED: uncharacterized protein LOC100846... 67 3e-09 gb|AFW04251.1| zinc finger C3HC4 type domain containing protein ... 67 4e-09 gb|AFW04243.1| zinc finger C3HC4 type domain containing protein ... 67 4e-09 >gb|AFK38398.1| unknown [Medicago truncatula] Length = 465 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 3/56 (5%) Frame = -2 Query: 726 AIDLTIVFLPLLIFETLVLVDNIR---ALMPVGEESLIDRTLWETLPHLSLSVSIV 568 A+DL IVFLPLL FE ++L+DN R ALMP EESL D +WETLPH +++S+V Sbjct: 103 AVDLKIVFLPLLTFEIIILIDNFRMCKALMPGDEESLSDEAIWETLPHFWVAISMV 158 >gb|AFW67871.1| putative RING zinc finger domain superfamily protein [Zea mays] Length = 472 Score = 67.4 bits (163), Expect = 3e-09 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 3/56 (5%) Frame = -2 Query: 726 AIDLTIVFLPLLIFETLVLVDNIR---ALMPVGEESLIDRTLWETLPHLSLSVSIV 568 ++DL IVFLPLL FE ++L+DN R ALMP EES+ D +WETLPH +S+S+V Sbjct: 109 SVDLKIVFLPLLAFEAIILIDNFRMCRALMPGDEESMSDEAIWETLPHFWVSISMV 164 >ref|XP_003560736.1| PREDICTED: uncharacterized protein LOC100846770 [Brachypodium distachyon] Length = 474 Score = 67.4 bits (163), Expect = 3e-09 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 3/56 (5%) Frame = -2 Query: 726 AIDLTIVFLPLLIFETLVLVDNIR---ALMPVGEESLIDRTLWETLPHLSLSVSIV 568 A+DL IVFLPLL FE ++L+DN R ALMP EES+ D +WETLPH +++S+V Sbjct: 110 AVDLKIVFLPLLTFEVIILIDNFRMCKALMPGDEESMSDEAIWETLPHFWVAISMV 165 >gb|AFW04251.1| zinc finger C3HC4 type domain containing protein [Triticum aestivum] Length = 473 Score = 67.0 bits (162), Expect = 4e-09 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 3/56 (5%) Frame = -2 Query: 726 AIDLTIVFLPLLIFETLVLVDNIR---ALMPVGEESLIDRTLWETLPHLSLSVSIV 568 A+D+ IVFLPLL FE ++LVDN R ALMP EES+ D +WETLPH +++S+V Sbjct: 109 AVDMKIVFLPLLTFEVIILVDNFRMCKALMPGDEESMSDEAIWETLPHFWVAISMV 164 >gb|AFW04243.1| zinc finger C3HC4 type domain containing protein [Triticum aestivum] Length = 473 Score = 67.0 bits (162), Expect = 4e-09 Identities = 32/56 (57%), Positives = 42/56 (75%), Gaps = 3/56 (5%) Frame = -2 Query: 726 AIDLTIVFLPLLIFETLVLVDNIR---ALMPVGEESLIDRTLWETLPHLSLSVSIV 568 A+D+ IVFLPLL FE ++LVDN R ALMP EES+ D +WETLPH +++S+V Sbjct: 109 AVDMKIVFLPLLTFEVIILVDNFRMCKALMPGDEESMSDEAIWETLPHFWVAISMV 164