BLASTX nr result
ID: Atractylodes21_contig00004344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00004344 (416 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530574.1| something about silencing protein sas10, put... 65 1e-16 ref|XP_003520178.1| PREDICTED: uncharacterized protein LOC100812... 68 4e-15 gb|AAT39972.1| Putative Sas10/Utp3 family protein, identical [So... 68 7e-15 ref|XP_003528493.1| PREDICTED: uncharacterized protein C3B8.09-l... 67 7e-14 gb|ABI34329.1| Integrase core domain containing protein [Solanum... 65 9e-14 >ref|XP_002530574.1| something about silencing protein sas10, putative [Ricinus communis] gi|223529873|gb|EEF31804.1| something about silencing protein sas10, putative [Ricinus communis] Length = 639 Score = 64.7 bits (156), Expect(2) = 1e-16 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -1 Query: 413 RLSQLVP-QMKKPRVISGDDDLPKRDDIGERRRKHELRVLA 294 +LSQLV + KP+ ISGDDDLPKRDDIGERRRKHE+RVLA Sbjct: 456 KLSQLVSAKANKPKAISGDDDLPKRDDIGERRRKHEIRVLA 496 Score = 46.2 bits (108), Expect(2) = 1e-16 Identities = 25/53 (47%), Positives = 31/53 (58%), Gaps = 4/53 (7%) Frame = -3 Query: 189 DDELVPEPGNLEGDGVNDTNETD----SEPDLYKETKIKRDVKLVAKAHKYSR 43 +D+ + EPG LE D +D E S + YKE K KRD K VAKA KY+R Sbjct: 503 EDDAIHEPGTLETDEPSDMEEDGDTGGSGDEFYKEIKQKRDAKFVAKAEKYAR 555 >ref|XP_003520178.1| PREDICTED: uncharacterized protein LOC100812322 [Glycine max] Length = 673 Score = 67.8 bits (164), Expect(2) = 4e-15 Identities = 33/41 (80%), Positives = 37/41 (90%), Gaps = 1/41 (2%) Frame = -1 Query: 413 RLSQLV-PQMKKPRVISGDDDLPKRDDIGERRRKHELRVLA 294 R+SQ + MKKP+V+SGDDDLPKRDDIGERRRKHELRVLA Sbjct: 488 RVSQFLNANMKKPKVVSGDDDLPKRDDIGERRRKHELRVLA 528 Score = 38.1 bits (87), Expect(2) = 4e-15 Identities = 21/55 (38%), Positives = 29/55 (52%) Frame = -3 Query: 192 DDDELVPEPGNLEGDGVNDTNETDSEPDLYKETKIKRDVKLVAKAHKYSRMSNLA 28 DDD++ N D D DSE + YK+ + R KL AKA YSR S+++ Sbjct: 538 DDDQMADLGPNEVTDEEEDGGSGDSENEFYKQVEQLRAAKLAAKAETYSRNSSVS 592 >gb|AAT39972.1| Putative Sas10/Utp3 family protein, identical [Solanum demissum] Length = 746 Score = 67.8 bits (164), Expect(2) = 7e-15 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -1 Query: 401 LVPQMKKPRVISGDDDLPKRDDIGERRRKHELRVLA 294 L PQ+ +P++ISGDDDLPKRDDIGERRRKHELRVLA Sbjct: 567 LTPQVARPKIISGDDDLPKRDDIGERRRKHELRVLA 602 Score = 37.4 bits (85), Expect(2) = 7e-15 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = -3 Query: 186 DELVPEPGNLEGDGV--NDTNETDSEPDLYKETKIKRDVKLVAKAHKYSR 43 D++ EPG+ D V +D +E DS+ + Y+E + + KL AK + YSR Sbjct: 610 DDVNDEPGDHASDDVATSDDSEMDSDMEFYREVEKQHSAKLAAKENMYSR 659 >ref|XP_003528493.1| PREDICTED: uncharacterized protein C3B8.09-like [Glycine max] Length = 668 Score = 66.6 bits (161), Expect(2) = 7e-14 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 389 MKKPRVISGDDDLPKRDDIGERRRKHELRVLA 294 MKKP+V+SGDDDLPKRDDIGERRRKHELRVLA Sbjct: 491 MKKPKVVSGDDDLPKRDDIGERRRKHELRVLA 522 Score = 35.0 bits (79), Expect(2) = 7e-14 Identities = 19/54 (35%), Positives = 29/54 (53%) Frame = -3 Query: 189 DDELVPEPGNLEGDGVNDTNETDSEPDLYKETKIKRDVKLVAKAHKYSRMSNLA 28 DD++ N D +D DSE + YK+ + R KL AKA YSR ++++ Sbjct: 534 DDQMTDLGPNEVTDEEDDGGSGDSENEFYKQVEQLRAAKLAAKAETYSRNTSVS 587 >gb|ABI34329.1| Integrase core domain containing protein [Solanum demissum] Length = 1775 Score = 64.7 bits (156), Expect(2) = 9e-14 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 401 LVPQMKKPRVISGDDDLPKRDDIGERRRKHELRVLA 294 L Q+ +P++ISGDDDLPKRDDIGERRRKHELRVLA Sbjct: 1596 LTSQVARPKIISGDDDLPKRDDIGERRRKHELRVLA 1631 Score = 36.6 bits (83), Expect(2) = 9e-14 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = -3 Query: 186 DELVPEPGNLEGDGV--NDTNETDSEPDLYKETKIKRDVKLVAKAHKYSR 43 D++ EPG+ D V +D +E DS+ + Y+E + + KL AK YSR Sbjct: 1639 DDVNDEPGDHASDDVATSDDSEMDSDMEFYREVEKQHSAKLAAKEKMYSR 1688