BLASTX nr result
ID: Atractylodes21_contig00004276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00004276 (677 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_188271.1| auxin-responsive protein IAA26 [Arabidopsis tha... 68 1e-09 gb|ADL70746.1| indole-3-acetic acid inducible 26 [Arabidopsis th... 68 1e-09 gb|ADL70743.1| indole-3-acetic acid inducible 26 [Arabidopsis th... 68 1e-09 gb|ADL70741.1| indole-3-acetic acid inducible 26 [Arabidopsis th... 68 1e-09 gb|ADL70736.1| indole-3-acetic acid inducible 26 [Arabidopsis th... 68 1e-09 >ref|NP_188271.1| auxin-responsive protein IAA26 [Arabidopsis thaliana] gi|46395896|sp|Q8LAL2.2|IAA26_ARATH RecName: Full=Auxin-responsive protein IAA26; AltName: Full=Indoleacetic acid-induced protein 26; AltName: Full=Phytochrome-associated protein 1 gi|12083212|gb|AAG48765.1|AF332401_1 putative phytochrome-associated protein 1 [Arabidopsis thaliana] gi|14423422|gb|AAK62393.1|AF386948_1 phytochrome-associated protein 1 [Arabidopsis thaliana] gi|30410707|gb|AAG48758.2|AF332394_1 auxin-induced protein AUX2-11 [Arabidopsis thaliana] gi|9279649|dbj|BAB01149.1| phytochrome-associated protein 1 [Arabidopsis thaliana] gi|18377502|gb|AAL66917.1| phytochrome-associated protein 1 [Arabidopsis thaliana] gi|332642306|gb|AEE75827.1| auxin-responsive protein IAA26 [Arabidopsis thaliana] Length = 269 Score = 68.2 bits (165), Expect = 1e-09 Identities = 43/110 (39%), Positives = 52/110 (47%), Gaps = 22/110 (20%) Frame = -1 Query: 266 LDLIPKERNWFAKRDDDNIKGLRRNHGDVCVSDEKKLELRLGPPG--------------- 132 LDLIP+ R W+ + D +N EKKLELRLGPPG Sbjct: 15 LDLIPQGRKWY-QEDKNN------------TDQEKKLELRLGPPGGDEEDHSAIKKKNTE 61 Query: 131 -------VEDWSLSDVPRNYKSPAKAAVPVPNTSQKRSAPAPVVGWPPIR 3 ED S N+ SP+ VP+ SQKR+AP PVVGWPP+R Sbjct: 62 IRNIKKETEDKSFHCFNGNHFSPSNKTTSVPHISQKRTAPGPVVGWPPVR 111 >gb|ADL70746.1| indole-3-acetic acid inducible 26 [Arabidopsis thaliana] Length = 225 Score = 68.2 bits (165), Expect = 1e-09 Identities = 43/110 (39%), Positives = 52/110 (47%), Gaps = 22/110 (20%) Frame = -1 Query: 266 LDLIPKERNWFAKRDDDNIKGLRRNHGDVCVSDEKKLELRLGPPG--------------- 132 LDLIP+ R W+ + D +N EKKLELRLGPPG Sbjct: 5 LDLIPQGRKWY-QEDKNN------------TDQEKKLELRLGPPGGDEEDHSAIKKKNTE 51 Query: 131 -------VEDWSLSDVPRNYKSPAKAAVPVPNTSQKRSAPAPVVGWPPIR 3 ED S N+ SP+ VP+ SQKR+AP PVVGWPP+R Sbjct: 52 IRNIKKETEDKSFHCFNGNHFSPSNKTTSVPHISQKRTAPGPVVGWPPVR 101 >gb|ADL70743.1| indole-3-acetic acid inducible 26 [Arabidopsis thaliana] Length = 233 Score = 68.2 bits (165), Expect = 1e-09 Identities = 43/110 (39%), Positives = 52/110 (47%), Gaps = 22/110 (20%) Frame = -1 Query: 266 LDLIPKERNWFAKRDDDNIKGLRRNHGDVCVSDEKKLELRLGPPG--------------- 132 LDLIP+ R W+ + D +N EKKLELRLGPPG Sbjct: 15 LDLIPQGRKWY-QEDKNN------------TDQEKKLELRLGPPGGDEEDHSAIKKKNTE 61 Query: 131 -------VEDWSLSDVPRNYKSPAKAAVPVPNTSQKRSAPAPVVGWPPIR 3 ED S N+ SP+ VP+ SQKR+AP PVVGWPP+R Sbjct: 62 IRNIKKETEDKSFHCFNGNHFSPSNKTTSVPHISQKRTAPGPVVGWPPVR 111 >gb|ADL70741.1| indole-3-acetic acid inducible 26 [Arabidopsis thaliana] Length = 224 Score = 68.2 bits (165), Expect = 1e-09 Identities = 43/110 (39%), Positives = 52/110 (47%), Gaps = 22/110 (20%) Frame = -1 Query: 266 LDLIPKERNWFAKRDDDNIKGLRRNHGDVCVSDEKKLELRLGPPG--------------- 132 LDLIP+ R W+ + D +N EKKLELRLGPPG Sbjct: 5 LDLIPQGRKWY-QEDKNN------------TDQEKKLELRLGPPGGDEKDHSAIKKKNTE 51 Query: 131 -------VEDWSLSDVPRNYKSPAKAAVPVPNTSQKRSAPAPVVGWPPIR 3 ED S N+ SP+ VP+ SQKR+AP PVVGWPP+R Sbjct: 52 IRNIKKETEDKSFHCFNGNHFSPSNKTTSVPHISQKRTAPGPVVGWPPVR 101 >gb|ADL70736.1| indole-3-acetic acid inducible 26 [Arabidopsis thaliana] gi|304322500|gb|ADL70737.1| indole-3-acetic acid inducible 26 [Arabidopsis thaliana] gi|304322502|gb|ADL70738.1| indole-3-acetic acid inducible 26 [Arabidopsis thaliana] Length = 235 Score = 68.2 bits (165), Expect = 1e-09 Identities = 43/110 (39%), Positives = 52/110 (47%), Gaps = 22/110 (20%) Frame = -1 Query: 266 LDLIPKERNWFAKRDDDNIKGLRRNHGDVCVSDEKKLELRLGPPG--------------- 132 LDLIP+ R W+ + D +N EKKLELRLGPPG Sbjct: 15 LDLIPQGRKWY-QEDKNN------------TDQEKKLELRLGPPGGDEEDHSAIKKKNTE 61 Query: 131 -------VEDWSLSDVPRNYKSPAKAAVPVPNTSQKRSAPAPVVGWPPIR 3 ED S N+ SP+ VP+ SQKR+AP PVVGWPP+R Sbjct: 62 IRNIKKETEDKSFHCFNGNHFSPSNKTTSVPHISQKRTAPGPVVGWPPVR 111