BLASTX nr result
ID: Atractylodes21_contig00004192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00004192 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523968.1| interferon-induced GTP-binding protein mx, p... 64 2e-08 ref|XP_002468149.1| hypothetical protein SORBIDRAFT_01g040460 [S... 60 2e-07 ref|XP_003561799.1| PREDICTED: uncharacterized protein LOC100838... 60 2e-07 ref|XP_002888139.1| dynamin family protein [Arabidopsis lyrata s... 59 4e-07 ref|XP_002304086.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 >ref|XP_002523968.1| interferon-induced GTP-binding protein mx, putative [Ricinus communis] gi|223536695|gb|EEF38336.1| interferon-induced GTP-binding protein mx, putative [Ricinus communis] Length = 667 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 119 VIHSPLVSSYNDKIRPILDAVDKLRRLKVTQEGIPLPTI 3 VIH P+VSSYND+IRP+LDAVDKLR L V +EGI LPTI Sbjct: 26 VIHVPIVSSYNDRIRPLLDAVDKLRHLMVMKEGIQLPTI 64 >ref|XP_002468149.1| hypothetical protein SORBIDRAFT_01g040460 [Sorghum bicolor] gi|241922003|gb|EER95147.1| hypothetical protein SORBIDRAFT_01g040460 [Sorghum bicolor] Length = 647 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -2 Query: 128 AGEVIHSPLVSSYNDKIRPILDAVDKLRRLKVTQEGIPLPTI 3 A V S + +SYND+IRP+LDAVD+LR LKVTQEGI LPTI Sbjct: 26 ASGVTASAIAASYNDQIRPVLDAVDRLRHLKVTQEGIQLPTI 67 >ref|XP_003561799.1| PREDICTED: uncharacterized protein LOC100838755 [Brachypodium distachyon] Length = 1404 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -2 Query: 128 AGEVIHSPLVSSYNDKIRPILDAVDKLRRLKVTQEGIPLPTI 3 A V S + +SYND+IRP+LDAVD+LR LKVTQEGI LPTI Sbjct: 756 ASVVTGSAIAASYNDQIRPLLDAVDRLRHLKVTQEGIQLPTI 797 >ref|XP_002888139.1| dynamin family protein [Arabidopsis lyrata subsp. lyrata] gi|297333980|gb|EFH64398.1| dynamin family protein [Arabidopsis lyrata subsp. lyrata] Length = 659 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -2 Query: 134 NNAGEVIHSPLVSSYNDKIRPILDAVDKLRRLKVTQEGIPLPTI 3 N A I +P+VSSYND+IRP+LD VD+LR L V +EGI LPTI Sbjct: 26 NKAVVPIEAPIVSSYNDRIRPLLDTVDRLRNLNVMREGIQLPTI 69 >ref|XP_002304086.1| predicted protein [Populus trichocarpa] gi|222841518|gb|EEE79065.1| predicted protein [Populus trichocarpa] Length = 667 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -2 Query: 119 VIHSPLVSSYNDKIRPILDAVDKLRRLKVTQEGIPLPTI 3 V H P+VSS+N++IRP+LDAVDKLR L+V +EGI LPTI Sbjct: 25 VSHVPIVSSFNERIRPLLDAVDKLRHLQVMKEGIQLPTI 63