BLASTX nr result
ID: Atractylodes21_contig00003748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00003748 (1060 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317591.1| predicted protein [Populus trichocarpa] gi|2... 50 2e-06 >ref|XP_002317591.1| predicted protein [Populus trichocarpa] gi|222860656|gb|EEE98203.1| predicted protein [Populus trichocarpa] Length = 432 Score = 49.7 bits (117), Expect(3) = 2e-06 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = +3 Query: 417 FKAQLKATNMYNEANFGHVELKIGNSTHAFWSWNR 521 +K A +++ EA+FGH ELK+ NSTHAFWSW+R Sbjct: 361 YKNPQPAWSVFREASFGHGELKLANSTHAFWSWHR 395 Score = 25.8 bits (55), Expect(3) = 2e-06 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = +2 Query: 518 QNDDDEPLRSDE 553 +NDDDEP+RSD+ Sbjct: 395 RNDDDEPVRSDQ 406 Score = 22.3 bits (46), Expect(3) = 2e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 Query: 298 GNKEGLAHK 324 GN+EGLAHK Sbjct: 352 GNREGLAHK 360