BLASTX nr result
ID: Atractylodes21_contig00003142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00003142 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADR71269.1| 60S ribosomal protein L18aA [Hevea brasiliensis] 64 1e-08 ref|XP_002530136.1| 60S ribosomal protein L18a, plant, putative ... 64 1e-08 ref|XP_002298923.1| predicted protein [Populus trichocarpa] gi|1... 62 4e-08 gb|AFK49106.1| unknown [Lotus japonicus] 62 6e-08 ref|XP_002276545.1| PREDICTED: 60S ribosomal protein L18a isofor... 61 8e-08 >gb|ADR71269.1| 60S ribosomal protein L18aA [Hevea brasiliensis] Length = 151 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 161 PGYAVAEGRPVRERRLPCCGIGIGWFL 241 PGYAVAEGRPVRERRLPCCGIG+GWFL Sbjct: 69 PGYAVAEGRPVRERRLPCCGIGVGWFL 95 >ref|XP_002530136.1| 60S ribosomal protein L18a, plant, putative [Ricinus communis] gi|223530361|gb|EEF32252.1| 60S ribosomal protein L18a, plant, putative [Ricinus communis] Length = 166 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 161 PGYAVAEGRPVRERRLPCCGIGIGWFL 241 PGYAVAEGRPVRERRLPCCGIG+GWFL Sbjct: 83 PGYAVAEGRPVRERRLPCCGIGVGWFL 109 >ref|XP_002298923.1| predicted protein [Populus trichocarpa] gi|118486768|gb|ABK95219.1| unknown [Populus trichocarpa] gi|222846181|gb|EEE83728.1| predicted protein [Populus trichocarpa] Length = 156 Score = 62.4 bits (150), Expect = 4e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 140 SQGPDL*PGYAVAEGRPVRERRLPCCGIGIGWFL 241 +QG PGYAVAEGRPVR+RRLPCCG G+GWFL Sbjct: 66 AQGYQTVPGYAVAEGRPVRQRRLPCCGCGVGWFL 99 >gb|AFK49106.1| unknown [Lotus japonicus] Length = 152 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/66 (48%), Positives = 39/66 (59%) Frame = +2 Query: 44 FQGHDPFFSLDFRVTIRSSPSISGARSVFLARSQGPDL*PGYAVAEGRPVRERRLPCCGI 223 FQG ++ S S GA + + + QG P YAVAEGRPVRERRL CCG+ Sbjct: 28 FQGVANYYPSPPPPNPNSPASNGGAYAYYQGQGQGYHALPVYAVAEGRPVRERRLCCCGL 87 Query: 224 GIGWFL 241 G+GWFL Sbjct: 88 GLGWFL 93 >ref|XP_002276545.1| PREDICTED: 60S ribosomal protein L18a isoform 2 [Vitis vinifera] Length = 299 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = +2 Query: 140 SQGPDL*PGYAVAEGRPVRERRLPCCGIGIGWFL 241 S G PGYAV EGRPVRERRLPCCGIGIGW L Sbjct: 55 SHGYQTVPGYAVVEGRPVRERRLPCCGIGIGWLL 88