BLASTX nr result
ID: Atractylodes21_contig00002595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00002595 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321996.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 gb|AAY89380.1| starch synthase isoform 1 [Nicotiana langsdorffii... 62 6e-08 ref|XP_003527986.1| PREDICTED: soluble starch synthase, chloropl... 61 8e-08 ref|XP_003602259.1| Soluble starch synthase [Medicago truncatula... 61 8e-08 gb|ABV25893.1| starch synthase isoform I [Manihot esculenta] 61 8e-08 >ref|XP_002321996.1| predicted protein [Populus trichocarpa] gi|222868992|gb|EEF06123.1| predicted protein [Populus trichocarpa] Length = 649 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -2 Query: 199 ASHYDMDDLSGKVECKIALQKELGLPVLPDCPFIDISIRISVKR 68 AS+Y +DDLSGKV+CKIALQKELGLP+ PDCP I R+ ++ Sbjct: 425 ASNYSVDDLSGKVQCKIALQKELGLPIKPDCPLIGFIGRLDYQK 468 >gb|AAY89380.1| starch synthase isoform 1 [Nicotiana langsdorffii x Nicotiana sanderae] Length = 336 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -2 Query: 199 ASHYDMDDLSGKVECKIALQKELGLPVLPDCPFIDISIRISVKR 68 ASHY ++DLSGKV+CK ALQKELGLP+ PDCP I R+ ++ Sbjct: 267 ASHYSINDLSGKVKCKTALQKELGLPIRPDCPLIGFIGRLDYQK 310 >ref|XP_003527986.1| PREDICTED: soluble starch synthase, chloroplastic/amyloplastic-like [Glycine max] Length = 647 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 199 ASHYDMDDLSGKVECKIALQKELGLPVLPDCPFIDISIRISVKR 68 AS+Y DDLSGK ECKI+LQKELGLPV PDCP I R+ ++ Sbjct: 425 ASNYSADDLSGKAECKISLQKELGLPVRPDCPMIGFIGRLDYQK 468 >ref|XP_003602259.1| Soluble starch synthase [Medicago truncatula] gi|355491307|gb|AES72510.1| Soluble starch synthase [Medicago truncatula] Length = 655 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -2 Query: 199 ASHYDMDDLSGKVECKIALQKELGLPVLPDCPFIDISIRISVKR 68 AS Y DDLSGKV+CKIALQKELGLPV PDCP I R+ ++ Sbjct: 427 ASSYSADDLSGKVKCKIALQKELGLPVRPDCPVIGFVGRLDYQK 470 >gb|ABV25893.1| starch synthase isoform I [Manihot esculenta] Length = 633 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -2 Query: 199 ASHYDMDDLSGKVECKIALQKELGLPVLPDCPFIDISIRISVKR 68 A+HY +DDLSGKV+CKIALQKELGLP+ P CP I R+ ++ Sbjct: 409 AAHYSVDDLSGKVQCKIALQKELGLPIRPMCPLIGFIGRLDYQK 452