BLASTX nr result
ID: Atractylodes21_contig00002323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00002323 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB66002.1| cofactor-independent phosphoglyceromutase [Apium... 74 1e-11 sp|O24246.1|PMGI_PRUDU RecName: Full=2,3-bisphosphoglycerate-ind... 73 2e-11 ref|XP_003534616.1| PREDICTED: 2,3-bisphosphoglycerate-independe... 71 8e-11 gb|AFK39515.1| unknown [Medicago truncatula] 70 2e-10 ref|XP_003623691.1| 2,3-bisphosphoglycerate-independent phosphog... 70 2e-10 >emb|CAB66002.1| cofactor-independent phosphoglyceromutase [Apium graveolens] Length = 559 Score = 73.9 bits (180), Expect = 1e-11 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = -1 Query: 298 LAGGVKFREDVPNGGLANVAATVMNLHGFVAPDDYETSLIE 176 L GV++R+DVP+GGLANVAATVMNLHGFVAPDDYET+LIE Sbjct: 515 LLPGVRYRKDVPSGGLANVAATVMNLHGFVAPDDYETTLIE 555 >sp|O24246.1|PMGI_PRUDU RecName: Full=2,3-bisphosphoglycerate-independent phosphoglycerate mutase; Short=BPG-independent PGAM; Short=Phosphoglyceromutase; AltName: Full=PGAM-I gi|1498232|emb|CAA52928.1| phosphoglycerate mutase [Prunus dulcis] gi|1585833|prf||2202194A 2,3-bisphosphoglycerate-independent phosphoglycerate mutase Length = 488 Score = 73.2 bits (178), Expect = 2e-11 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -1 Query: 298 LAGGVKFREDVPNGGLANVAATVMNLHGFVAPDDYETSLIE 176 LA GV+FR+DVPNGGLANVAATVMNLHGF AP DYET+LIE Sbjct: 444 LAPGVQFRKDVPNGGLANVAATVMNLHGFEAPADYETTLIE 484 >ref|XP_003534616.1| PREDICTED: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase-like [Glycine max] Length = 559 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 298 LAGGVKFREDVPNGGLANVAATVMNLHGFVAPDDYETSLIE 176 LA GV+FR DVP GGLANVAATVMNLHGF AP DYET+L+E Sbjct: 515 LAPGVRFRNDVPTGGLANVAATVMNLHGFEAPSDYETTLVE 555 >gb|AFK39515.1| unknown [Medicago truncatula] Length = 421 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -1 Query: 298 LAGGVKFREDVPNGGLANVAATVMNLHGFVAPDDYETSLIE 176 L GV+FR DVP GGLANVAATVMNLHGF AP DYET+LIE Sbjct: 379 LTPGVRFRNDVPTGGLANVAATVMNLHGFEAPSDYETTLIE 419 >ref|XP_003623691.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Medicago truncatula] gi|355498706|gb|AES79909.1| 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [Medicago truncatula] Length = 508 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -1 Query: 298 LAGGVKFREDVPNGGLANVAATVMNLHGFVAPDDYETSLIE 176 L GV+FR DVP GGLANVAATVMNLHGF AP DYET+LIE Sbjct: 466 LTPGVRFRNDVPTGGLANVAATVMNLHGFEAPSDYETTLIE 506