BLASTX nr result
ID: Atractylodes21_contig00002107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00002107 (617 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519846.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002519846.1| conserved hypothetical protein [Ricinus communis] gi|223540892|gb|EEF42450.1| conserved hypothetical protein [Ricinus communis] Length = 154 Score = 57.8 bits (138), Expect = 2e-06 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 1/81 (1%) Frame = +3 Query: 45 KEVGSDVSDDLIRESLIAISYSLPDK-QFPLKDLPRISSSPKNAGDAANIDEKEKCRAEL 221 KE S DL RESLI ISYSLP+K Q P D+ IS G+ N D ++ R+EL Sbjct: 4 KEACKQASQDLARESLIEISYSLPEKVQTP--DVGEIS-----VGEDMNNDGADRFRSEL 56 Query: 222 ISISYAQSPDTKGLPGKSKGQ 284 ISISY+QSPD P S+ Q Sbjct: 57 ISISYSQSPDITLSPVSSEKQ 77