BLASTX nr result
ID: Atractylodes21_contig00002104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00002104 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACZ51443.1| peroxidase protein [Mikania micrantha] 82 3e-14 ref|XP_002982182.1| hypothetical protein SELMODRAFT_421525 [Sela... 81 1e-13 ref|XP_002994345.1| hypothetical protein SELMODRAFT_7760 [Selagi... 81 1e-13 ref|XP_002517727.1| Cationic peroxidase 1 precursor, putative [R... 81 1e-13 ref|XP_002319407.1| predicted protein [Populus trichocarpa] gi|2... 81 1e-13 >gb|ACZ51443.1| peroxidase protein [Mikania micrantha] Length = 321 Score = 82.4 bits (202), Expect = 3e-14 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -1 Query: 145 FTGEKTAAPNSNSLRGFNVIDTIKTQLESQCPGVVSCADILSAAAQSS 2 FTGEKTA PN+NSLRGF+VIDTIK+QLES CPGVVSCAD+L+ AA+ S Sbjct: 88 FTGEKTAGPNNNSLRGFDVIDTIKSQLESSCPGVVSCADLLATAARDS 135 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -2 Query: 414 CLWVLFGSTSGQLSANFYATTCPNLRSVITRAVNSAVSTEA 292 CL VL + GQLSANFYAT+CPN S+I+ AVNSAVS EA Sbjct: 17 CLCVLSDTALGQLSANFYATSCPNFSSIISSAVNSAVSNEA 57 >ref|XP_002982182.1| hypothetical protein SELMODRAFT_421525 [Selaginella moellendorffii] gi|300150198|gb|EFJ16850.1| hypothetical protein SELMODRAFT_421525 [Selaginella moellendorffii] Length = 328 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -1 Query: 145 FTGEKTAAPNSNSLRGFNVIDTIKTQLESQCPGVVSCADILSAAAQSS 2 FTGEK+A PN NSLRGF VID IK+QLESQCPG+VSCADI++ AAQ+S Sbjct: 85 FTGEKSAGPNKNSLRGFEVIDAIKSQLESQCPGIVSCADIVALAAQTS 132 >ref|XP_002994345.1| hypothetical protein SELMODRAFT_7760 [Selaginella moellendorffii] gi|300137757|gb|EFJ04588.1| hypothetical protein SELMODRAFT_7760 [Selaginella moellendorffii] Length = 128 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -1 Query: 145 FTGEKTAAPNSNSLRGFNVIDTIKTQLESQCPGVVSCADILSAAAQSS 2 FTGEK+A PN NSLRGF VID IK+QLESQCPG+VSCADI++ AAQ+S Sbjct: 22 FTGEKSAGPNKNSLRGFEVIDAIKSQLESQCPGIVSCADIVALAAQTS 69 >ref|XP_002517727.1| Cationic peroxidase 1 precursor, putative [Ricinus communis] gi|223543125|gb|EEF44659.1| Cationic peroxidase 1 precursor, putative [Ricinus communis] Length = 264 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -1 Query: 145 FTGEKTAAPNSNSLRGFNVIDTIKTQLESQCPGVVSCADILSAAAQSS 2 FTGEKTA PN+NSLRGF+VIDTIK+Q+ES CPGVVSCADIL+ AA+ S Sbjct: 31 FTGEKTAGPNANSLRGFDVIDTIKSQVESICPGVVSCADILAVAARDS 78 >ref|XP_002319407.1| predicted protein [Populus trichocarpa] gi|222857783|gb|EEE95330.1| predicted protein [Populus trichocarpa] Length = 302 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/48 (79%), Positives = 44/48 (91%) Frame = -1 Query: 145 FTGEKTAAPNSNSLRGFNVIDTIKTQLESQCPGVVSCADILSAAAQSS 2 FTGEKTA PN+NSLRG++VIDTIK+QLES CPGVVSCADIL+ AA+ S Sbjct: 69 FTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDS 116