BLASTX nr result
ID: Atractylodes21_contig00002096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00002096 (597 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001237104.1| cyclin-dependent kinases regulatory subunit ... 110 8e-25 ref|XP_002523737.1| Cyclin-dependent kinases regulatory subunit,... 109 8e-25 dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] 112 1e-24 ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyr... 111 1e-24 ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [... 111 1e-24 >ref|NP_001237104.1| cyclin-dependent kinases regulatory subunit [Glycine max] gi|356542684|ref|XP_003539796.1| PREDICTED: cyclin-dependent kinases regulatory subunit 2-like [Glycine max] gi|42362268|gb|AAS13367.1| cyclin-dependent kinases regulatory subunit [Glycine max] gi|255628843|gb|ACU14766.1| unknown [Glycine max] gi|388501782|gb|AFK38957.1| unknown [Lotus japonicus] Length = 88 Score = 110 bits (275), Expect(2) = 8e-25 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = -1 Query: 537 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSETEWRAIGVQQSRGWV 379 MGQIQYSEKYFDDT+EYRHVVLPPEVAKLLPKNRLLSE EWRAIGVQQSRGWV Sbjct: 1 MGQIQYSEKYFDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWV 53 Score = 28.9 bits (63), Expect(2) = 8e-25 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 283 PLNYQQNQENPAQAHQTLLAK 221 PLNYQQ QEN QA Q++L K Sbjct: 70 PLNYQQQQEN--QAQQSMLVK 88 >ref|XP_002523737.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] gi|223537041|gb|EEF38677.1| Cyclin-dependent kinases regulatory subunit, putative [Ricinus communis] Length = 88 Score = 109 bits (272), Expect(2) = 8e-25 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -1 Query: 537 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSETEWRAIGVQQSRGWV 379 MGQIQYSEKY+DDT+EYRHVVLPPEVAKLLPKNRLLSE EWRAIGVQQSRGWV Sbjct: 1 MGQIQYSEKYYDDTYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWV 53 Score = 30.0 bits (66), Expect(2) = 8e-25 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -3 Query: 283 PLNYQQNQENPAQAHQTLLAK 221 PLNYQQ QEN QA Q +LAK Sbjct: 70 PLNYQQQQEN--QAQQNILAK 88 >dbj|BAF36296.1| hypothetical protein [Ipomoea trifida] Length = 1291 Score = 112 bits (281), Expect(2) = 1e-24 Identities = 53/57 (92%), Positives = 55/57 (96%) Frame = -1 Query: 549 ISLIMGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSETEWRAIGVQQSRGWV 379 I++ MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSE EWRAIGVQQSRGWV Sbjct: 1200 IAVEMGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWV 1256 Score = 25.8 bits (55), Expect(2) = 1e-24 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 Query: 283 PLNYQQNQENPAQAHQTLLAK 221 PLNYQQ QE+ AQ + L+AK Sbjct: 1273 PLNYQQQQESQAQLN--LIAK 1291 >ref|XP_002879125.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] gi|297324964|gb|EFH55384.1| cdk-subunit 1 [Arabidopsis lyrata subsp. lyrata] Length = 87 Score = 111 bits (278), Expect(2) = 1e-24 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 537 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSETEWRAIGVQQSRGWV 379 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSE EWRAIGVQQSRGWV Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWV 53 Score = 26.9 bits (58), Expect(2) = 1e-24 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 283 PLNYQQNQENPAQ 245 PLNYQQ QEN AQ Sbjct: 70 PLNYQQQQENQAQ 82 >ref|NP_180363.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] gi|75097781|sp|O23249.1|CKS1_ARATH RecName: Full=Cyclin-dependent kinases regulatory subunit 1; AltName: Full=CKS1-At gi|2274859|emb|CAA03859.1| Cks1 protein [Arabidopsis thaliana] gi|4510420|gb|AAD21506.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|21593913|gb|AAM65878.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969580|dbj|BAD43482.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51969798|dbj|BAD43591.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|51970380|dbj|BAD43882.1| putative cyclin-dependent kinase regulatory subunit [Arabidopsis thaliana] gi|88010880|gb|ABD38867.1| At2g27960 [Arabidopsis thaliana] gi|330252970|gb|AEC08064.1| cyclin-dependent kinases regulatory subunit 1 [Arabidopsis thaliana] Length = 87 Score = 111 bits (278), Expect(2) = 1e-24 Identities = 52/53 (98%), Positives = 52/53 (98%) Frame = -1 Query: 537 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSETEWRAIGVQQSRGWV 379 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSE EWRAIGVQQSRGWV Sbjct: 1 MGQIQYSEKYFDDTFEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWV 53 Score = 26.9 bits (58), Expect(2) = 1e-24 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 283 PLNYQQNQENPAQ 245 PLNYQQ QEN AQ Sbjct: 70 PLNYQQQQENQAQ 82