BLASTX nr result
ID: Atractylodes21_contig00001035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00001035 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528632.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 tpg|DAA51123.1| TPA: hypothetical protein ZEAMMB73_068409 [Zea m... 60 2e-07 ref|XP_003632751.1| PREDICTED: uncharacterized protein LOC100240... 60 2e-07 ref|XP_002463955.1| hypothetical protein SORBIDRAFT_01g009520 [S... 60 2e-07 ref|XP_002283988.1| PREDICTED: uncharacterized protein LOC100240... 60 2e-07 >ref|XP_002528632.1| conserved hypothetical protein [Ricinus communis] gi|223531921|gb|EEF33735.1| conserved hypothetical protein [Ricinus communis] Length = 449 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 264 FVPMLTLVVGFDTKSAAALSKCMIMGASASS 172 FVPMLTL+VGFDTKSAAA+SKCMIMGASASS Sbjct: 83 FVPMLTLIVGFDTKSAAAISKCMIMGASASS 113 >tpg|DAA51123.1| TPA: hypothetical protein ZEAMMB73_068409 [Zea mays] Length = 199 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 264 FVPMLTLVVGFDTKSAAALSKCMIMGASASS 172 FVPML LVVGFDTKSAAALSKCMIMGASASS Sbjct: 102 FVPMLNLVVGFDTKSAAALSKCMIMGASASS 132 >ref|XP_003632751.1| PREDICTED: uncharacterized protein LOC100240792 isoform 2 [Vitis vinifera] Length = 369 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 264 FVPMLTLVVGFDTKSAAALSKCMIMGASASS 172 FVPMLTL+VGFDTKSAAALSKCMIMGAS SS Sbjct: 95 FVPMLTLIVGFDTKSAAALSKCMIMGASTSS 125 >ref|XP_002463955.1| hypothetical protein SORBIDRAFT_01g009520 [Sorghum bicolor] gi|241917809|gb|EER90953.1| hypothetical protein SORBIDRAFT_01g009520 [Sorghum bicolor] Length = 482 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 264 FVPMLTLVVGFDTKSAAALSKCMIMGASASS 172 FVPML LVVGFDTKSAAALSKCMIMGASASS Sbjct: 104 FVPMLNLVVGFDTKSAAALSKCMIMGASASS 134 >ref|XP_002283988.1| PREDICTED: uncharacterized protein LOC100240792 isoform 1 [Vitis vinifera] gi|297740033|emb|CBI30215.3| unnamed protein product [Vitis vinifera] Length = 469 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 264 FVPMLTLVVGFDTKSAAALSKCMIMGASASS 172 FVPMLTL+VGFDTKSAAALSKCMIMGAS SS Sbjct: 95 FVPMLTLIVGFDTKSAAALSKCMIMGASTSS 125