BLASTX nr result
ID: Atractylodes21_contig00001032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00001032 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597434.1| Proteasome subunit beta type [Medicago trunc... 100 1e-19 ref|NP_001030905.1| proteasome subunit beta type-1 [Arabidopsis ... 99 3e-19 ref|NP_191641.1| proteasome subunit beta type-1 [Arabidopsis tha... 99 3e-19 ref|XP_003532008.1| PREDICTED: proteasome subunit beta type-1-li... 99 3e-19 gb|ACU20595.1| unknown [Glycine max] 99 3e-19 >ref|XP_003597434.1| Proteasome subunit beta type [Medicago truncatula] gi|355486482|gb|AES67685.1| Proteasome subunit beta type [Medicago truncatula] Length = 231 Score = 100 bits (249), Expect = 1e-19 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +1 Query: 64 PIIMPKEHANWSPYDNNGGTCVAIAGADYCVIAADTRMSTGYSILTRDYSK 216 P M K+HANWSPYDNNGG+CVAIAG+DYCVIAADTRMSTGY+ILTRDYSK Sbjct: 6 PFTMTKQHANWSPYDNNGGSCVAIAGSDYCVIAADTRMSTGYNILTRDYSK 56 >ref|NP_001030905.1| proteasome subunit beta type-1 [Arabidopsis thaliana] gi|332646592|gb|AEE80113.1| proteasome subunit beta type-1 [Arabidopsis thaliana] Length = 223 Score = 99.4 bits (246), Expect = 3e-19 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 73 MPKEHANWSPYDNNGGTCVAIAGADYCVIAADTRMSTGYSILTRDYSK 216 M K+HANWSPYDNNGGTCVAIAG+DYCVIAADTRMSTGYSIL+RDYSK Sbjct: 1 MTKQHANWSPYDNNGGTCVAIAGSDYCVIAADTRMSTGYSILSRDYSK 48 >ref|NP_191641.1| proteasome subunit beta type-1 [Arabidopsis thaliana] gi|334186160|ref|NP_001190146.1| proteasome subunit beta type-1 [Arabidopsis thaliana] gi|297820934|ref|XP_002878350.1| hypothetical protein ARALYDRAFT_907612 [Arabidopsis lyrata subsp. lyrata] gi|12643281|sp|P42742.2|PSB1_ARATH RecName: Full=Proteasome subunit beta type-1; AltName: Full=20S proteasome beta subunit F-1; AltName: Full=Proteasome component 5; AltName: Full=Proteasome subunit beta type-6; AltName: Full=TAS-F22/FAFP98; AltName: Full=TAS-G39.20 gi|577531|emb|CAA56201.1| proteasome subunit [Arabidopsis thaliana] gi|3421120|gb|AAC32073.1| 20S proteasome beta subunit PBF1 [Arabidopsis thaliana] gi|7329692|emb|CAB82686.1| proteasome component C5 [Arabidopsis thaliana] gi|17065428|gb|AAL32868.1| proteasome component C5 [Arabidopsis thaliana] gi|20148485|gb|AAM10133.1| proteasome component C5 [Arabidopsis thaliana] gi|21554745|gb|AAM63678.1| proteasome component C5 [Arabidopsis thaliana] gi|297324188|gb|EFH54609.1| hypothetical protein ARALYDRAFT_907612 [Arabidopsis lyrata subsp. lyrata] gi|332646591|gb|AEE80112.1| proteasome subunit beta type-1 [Arabidopsis thaliana] gi|332646593|gb|AEE80114.1| proteasome subunit beta type-1 [Arabidopsis thaliana] Length = 223 Score = 99.4 bits (246), Expect = 3e-19 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 73 MPKEHANWSPYDNNGGTCVAIAGADYCVIAADTRMSTGYSILTRDYSK 216 M K+HANWSPYDNNGGTCVAIAG+DYCVIAADTRMSTGYSIL+RDYSK Sbjct: 1 MTKQHANWSPYDNNGGTCVAIAGSDYCVIAADTRMSTGYSILSRDYSK 48 >ref|XP_003532008.1| PREDICTED: proteasome subunit beta type-1-like [Glycine max] Length = 223 Score = 99.4 bits (246), Expect = 3e-19 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 73 MPKEHANWSPYDNNGGTCVAIAGADYCVIAADTRMSTGYSILTRDYSK 216 M K+HANWSPYDNNGG+CVAIAGADYCVIAADTRMSTGY+ILTRDYSK Sbjct: 1 MTKQHANWSPYDNNGGSCVAIAGADYCVIAADTRMSTGYNILTRDYSK 48 >gb|ACU20595.1| unknown [Glycine max] Length = 207 Score = 99.4 bits (246), Expect = 3e-19 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 73 MPKEHANWSPYDNNGGTCVAIAGADYCVIAADTRMSTGYSILTRDYSK 216 M K+HANWSPYDNNGG+CVAIAGADYCVIAADTRMSTGY+ILTRDYSK Sbjct: 1 MTKQHANWSPYDNNGGSCVAIAGADYCVIAADTRMSTGYNILTRDYSK 48