BLASTX nr result
ID: Atractylodes21_contig00000687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00000687 (1183 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABA27060.1| TO101-3 [Taraxacum officinale] 65 3e-08 gb|ACF15448.1| dehydrin 1 [Cichorium intybus] 59 2e-06 gb|AAF01465.2|AF190474_1 bdn1 [Paraboea crassifolia] 57 9e-06 >gb|ABA27060.1| TO101-3 [Taraxacum officinale] Length = 107 Score = 65.1 bits (157), Expect = 3e-08 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -2 Query: 642 DNTSVPIEKYEEVPPISHPTP-PEEKKGFMEKIKEKLPGGHKK 517 D TSVPIEKY+ P P P PEEKKGFMEKIKEKLPGGHK+ Sbjct: 33 DETSVPIEKYDVAPLHHTPNPEPEEKKGFMEKIKEKLPGGHKE 75 >gb|ACF15448.1| dehydrin 1 [Cichorium intybus] Length = 262 Score = 59.3 bits (142), Expect = 2e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -2 Query: 642 DNTSVPIEKYEEVPPISHPTPPEEKKGFMEKIKEKLPGGHKK 517 ++TSVPIEKYE P PT EKKGF+EKIKEKLPGG KK Sbjct: 124 EDTSVPIEKYEVTPLQHGPTSEPEKKGFIEKIKEKLPGGTKK 165 >gb|AAF01465.2|AF190474_1 bdn1 [Paraboea crassifolia] Length = 252 Score = 57.0 bits (136), Expect = 9e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 642 DNTSVPIEKYEEVPPISHPTPPEEKKGFMEKIKEKLPGGHK 520 + TSVP+EKY+E+ H PEEKKGF++KIKEKLPGG K Sbjct: 156 EETSVPVEKYDEI----HTLEPEEKKGFLDKIKEKLPGGKK 192