BLASTX nr result
ID: Atractylodes21_contig00000656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00000656 (525 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT38687.2| RNA-directed RNA polymerase, putative [Solanum de... 58 7e-07 gb|AAN64409.1| RNA-dependent RNA polymerase 1 [Arabidopsis thali... 55 8e-06 ref|NP_172932.1| RNA-dependent RNA polymerase 1 [Arabidopsis tha... 55 8e-06 emb|CCD74482.1| RNA-dependent RNA polymerase 1 [Arabidopsis hall... 55 8e-06 dbj|BAL63010.1| RNA-dependent RNA polymerase 1 [Cucumis sativus] 55 8e-06 >gb|AAT38687.2| RNA-directed RNA polymerase, putative [Solanum demissum] Length = 1139 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 91 SQTTCEYDYRPHPNECSGSDLDGDIYFVCW 2 S T +D RPHPNECSGSDLDGDIYFVCW Sbjct: 807 SDPTLCFDDRPHPNECSGSDLDGDIYFVCW 836 >gb|AAN64409.1| RNA-dependent RNA polymerase 1 [Arabidopsis thaliana] Length = 1107 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -3 Query: 64 RPHPNECSGSDLDGDIYFVCW 2 RPHPNECSGSDLDGDIYFVCW Sbjct: 787 RPHPNECSGSDLDGDIYFVCW 807 >ref|NP_172932.1| RNA-dependent RNA polymerase 1 [Arabidopsis thaliana] gi|75335341|sp|Q9LQV2.1|RDR1_ARATH RecName: Full=RNA-dependent RNA polymerase 1; Short=AtRDRP1; AltName: Full=RNA-directed RNA polymerase 1 gi|8778232|gb|AAF79241.1|AC006917_26 F10B6.19 [Arabidopsis thaliana] gi|110737376|dbj|BAF00633.1| putative RNA-directed RNA polymerase [Arabidopsis thaliana] gi|332191105|gb|AEE29226.1| RNA-dependent RNA polymerase 1 [Arabidopsis thaliana] Length = 1107 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -3 Query: 64 RPHPNECSGSDLDGDIYFVCW 2 RPHPNECSGSDLDGDIYFVCW Sbjct: 787 RPHPNECSGSDLDGDIYFVCW 807 >emb|CCD74482.1| RNA-dependent RNA polymerase 1 [Arabidopsis halleri subsp. halleri] Length = 1107 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -3 Query: 64 RPHPNECSGSDLDGDIYFVCW 2 RPHPNECSGSDLDGDIYFVCW Sbjct: 788 RPHPNECSGSDLDGDIYFVCW 808 >dbj|BAL63010.1| RNA-dependent RNA polymerase 1 [Cucumis sativus] Length = 1115 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -3 Query: 64 RPHPNECSGSDLDGDIYFVCW 2 RPHPNECSGSDLDGDIYFVCW Sbjct: 801 RPHPNECSGSDLDGDIYFVCW 821