BLASTX nr result
ID: Atractylodes21_contig00000544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00000544 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002442154.1| hypothetical protein SORBIDRAFT_08g015240 [S... 57 2e-06 >ref|XP_002442154.1| hypothetical protein SORBIDRAFT_08g015240 [Sorghum bicolor] gi|241942847|gb|EES15992.1| hypothetical protein SORBIDRAFT_08g015240 [Sorghum bicolor] Length = 196 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/55 (50%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = +2 Query: 41 YNATGETVTYVTTYDWEGNVSGQ--YPVSIQNGQWAVFEHVGTRRPSRKGSVAAV 199 YNATG+T+ YVT +DW G + YP + NGQWA F HV R+ GSV AV Sbjct: 53 YNATGDTLRYVTNHDWYGYIGSTVGYPAEVGNGQWAAFHHV-HRQGEPSGSVGAV 106