BLASTX nr result
ID: Atractylodes21_contig00000511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes21_contig00000511 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF43095.1|AF053769_1 homeodomain protein [Malus x domestica] 57 2e-06 >gb|AAF43095.1|AF053769_1 homeodomain protein [Malus x domestica] Length = 809 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 10/52 (19%) Frame = -2 Query: 128 NSMSQDY---IFNFSHGFQRPS-------QDQQQNHIGHQIRRDKMRVQGFE 3 NSMSQDY IF FS+GF+R + Q QQQ+H+ QIRR+K+RVQGFE Sbjct: 35 NSMSQDYHQGIFTFSNGFERSAMTTHQEQQQQQQHHLAQQIRREKLRVQGFE 86