BLASTX nr result
ID: Astragalus24_contig00029992
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029992 (232 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN01620.1| Endoplasmic oxidoreductin-1, partial [Glycine soja] 144 7e-42 dbj|GAU37825.1| hypothetical protein TSUD_63870, partial [Trifol... 148 3e-41 ref|XP_003595530.1| endoplasmic oxidoreductin protein [Medicago ... 148 7e-41 ref|XP_004511502.1| PREDICTED: endoplasmic reticulum oxidoreduct... 147 2e-40 ref|XP_020233379.1| endoplasmic reticulum oxidoreductin-1-like [... 145 7e-40 gb|KRH12795.1| hypothetical protein GLYMA_15G194900 [Glycine max] 144 1e-39 gb|KHN31709.1| Endoplasmic oxidoreductin-1 [Glycine soja] 136 1e-39 ref|XP_006597929.1| PREDICTED: endoplasmic oxidoreductin-1-like ... 144 2e-39 ref|NP_001304609.1| endoplasmic reticulum oxidoreductin-1 [Glyci... 144 2e-39 gb|KHN37160.1| Endoplasmic oxidoreductin-2 [Glycine soja] >gi|94... 144 2e-39 ref|NP_001276132.1| endoplasmic oxidoreductin-1-like [Glycine ma... 144 2e-39 gb|KDO75420.1| hypothetical protein CISIN_1g012278mg [Citrus sin... 141 9e-39 gb|ONI11040.1| hypothetical protein PRUPE_4G084000 [Prunus persica] 140 2e-38 gb|KDO75419.1| hypothetical protein CISIN_1g012278mg [Citrus sin... 141 2e-38 gb|ESR62252.1| hypothetical protein CICLE_v10015325mg [Citrus cl... 141 2e-38 ref|XP_020103938.1| endoplasmic reticulum oxidoreductin-1-like i... 141 2e-38 ref|XP_004488286.1| PREDICTED: endoplasmic reticulum oxidoreduct... 141 2e-38 ref|XP_020103937.1| endoplasmic reticulum oxidoreductin-1-like i... 141 2e-38 gb|OAY80841.1| Endoplasmic reticulum oxidoreductin-1 [Ananas com... 141 2e-38 ref|XP_019415786.1| PREDICTED: endoplasmic reticulum oxidoreduct... 141 3e-38 >gb|KHN01620.1| Endoplasmic oxidoreductin-1, partial [Glycine soja] Length = 206 Score = 144 bits (363), Expect = 7e-42 Identities = 69/76 (90%), Positives = 73/76 (96%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKA+DYLE AEY+TGNPNEDL TQSLIKQLL Sbjct: 65 LTLMYDRVLRYPDRVRNLYFTFLFVLRAVTKASDYLEQAEYDTGNPNEDLTTQSLIKQLL 124 Query: 181 YNPKLQAACPVPFDEA 228 YNPKLQAACP+PFDEA Sbjct: 125 YNPKLQAACPIPFDEA 140 >dbj|GAU37825.1| hypothetical protein TSUD_63870, partial [Trifolium subterraneum] Length = 410 Score = 148 bits (373), Expect = 3e-41 Identities = 71/77 (92%), Positives = 75/77 (97%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTL+YDRVL+YPDR RNLYFTFLFVLRAVTKAADYLE AEYNTGNPNEDL+T+SLIKQLL Sbjct: 264 LTLLYDRVLQYPDRVRNLYFTFLFVLRAVTKAADYLEQAEYNTGNPNEDLRTESLIKQLL 323 Query: 181 YNPKLQAACPVPFDEAK 231 YNPKLQAACPVPFDEAK Sbjct: 324 YNPKLQAACPVPFDEAK 340 >ref|XP_003595530.1| endoplasmic oxidoreductin protein [Medicago truncatula] gb|AES65781.1| endoplasmic oxidoreductin protein [Medicago truncatula] Length = 464 Score = 148 bits (373), Expect = 7e-41 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKAADYLE AEYNTGNPNEDLKT+SLIKQLL Sbjct: 265 LTLMYDRVLQYPDRVRNLYFTFLFVLRAVTKAADYLEQAEYNTGNPNEDLKTESLIKQLL 324 Query: 181 YNPKLQAACPVPFDEAK 231 Y PKLQAACPVPFDEAK Sbjct: 325 YKPKLQAACPVPFDEAK 341 >ref|XP_004511502.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Cicer arietinum] Length = 465 Score = 147 bits (370), Expect = 2e-40 Identities = 71/77 (92%), Positives = 73/77 (94%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LT+MYDRVL+YPDR RNLYFTFLFVLRAVTKAADYLE AEYNT NPNEDLKTQS IKQLL Sbjct: 266 LTMMYDRVLQYPDRVRNLYFTFLFVLRAVTKAADYLEQAEYNTSNPNEDLKTQSFIKQLL 325 Query: 181 YNPKLQAACPVPFDEAK 231 YNPKLQAACPVPFDEAK Sbjct: 326 YNPKLQAACPVPFDEAK 342 >ref|XP_020233379.1| endoplasmic reticulum oxidoreductin-1-like [Cajanus cajan] gb|KYP49175.1| Endoplasmic oxidoreductin-2 [Cajanus cajan] Length = 462 Score = 145 bits (366), Expect = 7e-40 Identities = 70/76 (92%), Positives = 73/76 (96%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVLKYPDR RNLYFTFLFVLRAVTKAADYL+ AEY+TGNP EDLKTQSLIKQLL Sbjct: 263 LTLMYDRVLKYPDRVRNLYFTFLFVLRAVTKAADYLDQAEYDTGNPTEDLKTQSLIKQLL 322 Query: 181 YNPKLQAACPVPFDEA 228 YNPKLQAACP+PFDEA Sbjct: 323 YNPKLQAACPIPFDEA 338 >gb|KRH12795.1| hypothetical protein GLYMA_15G194900 [Glycine max] Length = 425 Score = 144 bits (363), Expect = 1e-39 Identities = 69/76 (90%), Positives = 73/76 (96%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKA+DYLE AEY+TGNPNEDL TQSLIKQLL Sbjct: 264 LTLMYDRVLRYPDRVRNLYFTFLFVLRAVTKASDYLEQAEYDTGNPNEDLTTQSLIKQLL 323 Query: 181 YNPKLQAACPVPFDEA 228 YNPKLQAACP+PFDEA Sbjct: 324 YNPKLQAACPIPFDEA 339 >gb|KHN31709.1| Endoplasmic oxidoreductin-1 [Glycine soja] Length = 132 Score = 136 bits (342), Expect = 1e-39 Identities = 65/73 (89%), Positives = 69/73 (94%) Frame = +1 Query: 10 MYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLLYNP 189 MYDRVL+YPD RNLYFTFLFVLRAVTKA+DYLE AEY+TGNPNEDL TQSLIKQLLYNP Sbjct: 1 MYDRVLRYPDCVRNLYFTFLFVLRAVTKASDYLEQAEYDTGNPNEDLTTQSLIKQLLYNP 60 Query: 190 KLQAACPVPFDEA 228 KLQAACP+PFDEA Sbjct: 61 KLQAACPIPFDEA 73 >ref|XP_006597929.1| PREDICTED: endoplasmic oxidoreductin-1-like isoform X1 [Glycine max] gb|KRH12794.1| hypothetical protein GLYMA_15G194900 [Glycine max] Length = 463 Score = 144 bits (363), Expect = 2e-39 Identities = 69/76 (90%), Positives = 73/76 (96%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKA+DYLE AEY+TGNPNEDL TQSLIKQLL Sbjct: 264 LTLMYDRVLRYPDRVRNLYFTFLFVLRAVTKASDYLEQAEYDTGNPNEDLTTQSLIKQLL 323 Query: 181 YNPKLQAACPVPFDEA 228 YNPKLQAACP+PFDEA Sbjct: 324 YNPKLQAACPIPFDEA 339 >ref|NP_001304609.1| endoplasmic reticulum oxidoreductin-1 [Glycine max] dbj|BAO31549.1| ER oxidoreductin 1b [Glycine max] Length = 465 Score = 144 bits (363), Expect = 2e-39 Identities = 69/76 (90%), Positives = 73/76 (96%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKA+DYLE AEY+TGNPNEDL TQSLIKQLL Sbjct: 264 LTLMYDRVLRYPDRVRNLYFTFLFVLRAVTKASDYLEQAEYDTGNPNEDLTTQSLIKQLL 323 Query: 181 YNPKLQAACPVPFDEA 228 YNPKLQAACP+PFDEA Sbjct: 324 YNPKLQAACPIPFDEA 339 >gb|KHN37160.1| Endoplasmic oxidoreductin-2 [Glycine soja] gb|KRH37751.1| hypothetical protein GLYMA_09G086800 [Glycine max] gb|KRH37752.1| hypothetical protein GLYMA_09G086800 [Glycine max] Length = 465 Score = 144 bits (363), Expect = 2e-39 Identities = 69/76 (90%), Positives = 73/76 (96%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKA+DYLE AEY+TGNPNEDL TQSLIKQLL Sbjct: 264 LTLMYDRVLRYPDRVRNLYFTFLFVLRAVTKASDYLEQAEYDTGNPNEDLTTQSLIKQLL 323 Query: 181 YNPKLQAACPVPFDEA 228 YNPKLQAACP+PFDEA Sbjct: 324 YNPKLQAACPIPFDEA 339 >ref|NP_001276132.1| endoplasmic oxidoreductin-1-like [Glycine max] dbj|BAO31548.1| ER oxidoreductin 1a [Glycine max] gb|KHN41699.1| Endoplasmic oxidoreductin-2 [Glycine soja] gb|KRH12793.1| hypothetical protein GLYMA_15G194900 [Glycine max] Length = 465 Score = 144 bits (363), Expect = 2e-39 Identities = 69/76 (90%), Positives = 73/76 (96%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKA+DYLE AEY+TGNPNEDL TQSLIKQLL Sbjct: 264 LTLMYDRVLRYPDRVRNLYFTFLFVLRAVTKASDYLEQAEYDTGNPNEDLTTQSLIKQLL 323 Query: 181 YNPKLQAACPVPFDEA 228 YNPKLQAACP+PFDEA Sbjct: 324 YNPKLQAACPIPFDEA 339 >gb|KDO75420.1| hypothetical protein CISIN_1g012278mg [Citrus sinensis] Length = 394 Score = 141 bits (355), Expect = 9e-39 Identities = 68/77 (88%), Positives = 73/77 (94%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKAA+YLE AEY TGNP EDLKTQSL+KQLL Sbjct: 270 LTLMYDRVLRYPDRVRNLYFTFLFVLRAVTKAAEYLEQAEYETGNPMEDLKTQSLMKQLL 329 Query: 181 YNPKLQAACPVPFDEAK 231 YNP+LQAACP+PFDEAK Sbjct: 330 YNPQLQAACPLPFDEAK 346 >gb|ONI11040.1| hypothetical protein PRUPE_4G084000 [Prunus persica] Length = 366 Score = 140 bits (352), Expect = 2e-38 Identities = 68/77 (88%), Positives = 72/77 (93%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 L LMYDRVL+YPDR RNLYFTFLFVLRAVTKAADYLE AEY+TGN NEDLKTQSL++QLL Sbjct: 260 LPLMYDRVLRYPDRVRNLYFTFLFVLRAVTKAADYLEHAEYDTGNLNEDLKTQSLVRQLL 319 Query: 181 YNPKLQAACPVPFDEAK 231 YNP LQAACPVPFDEAK Sbjct: 320 YNPNLQAACPVPFDEAK 336 >gb|KDO75419.1| hypothetical protein CISIN_1g012278mg [Citrus sinensis] Length = 429 Score = 141 bits (355), Expect = 2e-38 Identities = 68/77 (88%), Positives = 73/77 (94%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKAA+YLE AEY TGNP EDLKTQSL+KQLL Sbjct: 270 LTLMYDRVLRYPDRVRNLYFTFLFVLRAVTKAAEYLEQAEYETGNPMEDLKTQSLMKQLL 329 Query: 181 YNPKLQAACPVPFDEAK 231 YNP+LQAACP+PFDEAK Sbjct: 330 YNPQLQAACPLPFDEAK 346 >gb|ESR62252.1| hypothetical protein CICLE_v10015325mg [Citrus clementina] Length = 429 Score = 141 bits (355), Expect = 2e-38 Identities = 68/77 (88%), Positives = 73/77 (94%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKAA+YLE AEY TGNP EDLKTQSL+KQLL Sbjct: 270 LTLMYDRVLRYPDRVRNLYFTFLFVLRAVTKAAEYLEQAEYETGNPMEDLKTQSLMKQLL 329 Query: 181 YNPKLQAACPVPFDEAK 231 YNP+LQAACP+PFDEAK Sbjct: 330 YNPQLQAACPLPFDEAK 346 >ref|XP_020103938.1| endoplasmic reticulum oxidoreductin-1-like isoform X2 [Ananas comosus] Length = 464 Score = 141 bits (356), Expect = 2e-38 Identities = 67/77 (87%), Positives = 73/77 (94%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 L L+YDRVLKYPDR RNLYFTFLFVLRAVTKAADYLE AEY+TGNP EDLKTQSL++QL+ Sbjct: 276 LELLYDRVLKYPDRVRNLYFTFLFVLRAVTKAADYLEQAEYDTGNPQEDLKTQSLVRQLV 335 Query: 181 YNPKLQAACPVPFDEAK 231 YNPKLQAACP+PFDEAK Sbjct: 336 YNPKLQAACPLPFDEAK 352 >ref|XP_004488286.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Cicer arietinum] Length = 464 Score = 141 bits (356), Expect = 2e-38 Identities = 70/77 (90%), Positives = 72/77 (93%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTLMYDRVL+YPDR RNLYFTFLFVLRAVTKAADYLE AEYNTG+ NEDLKTQS IKQLL Sbjct: 265 LTLMYDRVLQYPDRVRNLYFTFLFVLRAVTKAADYLEQAEYNTGSHNEDLKTQSFIKQLL 324 Query: 181 YNPKLQAACPVPFDEAK 231 YN KLQAACPVPFDEAK Sbjct: 325 YNSKLQAACPVPFDEAK 341 >ref|XP_020103937.1| endoplasmic reticulum oxidoreductin-1-like isoform X1 [Ananas comosus] Length = 467 Score = 141 bits (356), Expect = 2e-38 Identities = 67/77 (87%), Positives = 73/77 (94%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 L L+YDRVLKYPDR RNLYFTFLFVLRAVTKAADYLE AEY+TGNP EDLKTQSL++QL+ Sbjct: 279 LELLYDRVLKYPDRVRNLYFTFLFVLRAVTKAADYLEQAEYDTGNPQEDLKTQSLVRQLV 338 Query: 181 YNPKLQAACPVPFDEAK 231 YNPKLQAACP+PFDEAK Sbjct: 339 YNPKLQAACPLPFDEAK 355 >gb|OAY80841.1| Endoplasmic reticulum oxidoreductin-1 [Ananas comosus] Length = 469 Score = 141 bits (356), Expect = 2e-38 Identities = 67/77 (87%), Positives = 73/77 (94%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 L L+YDRVLKYPDR RNLYFTFLFVLRAVTKAADYLE AEY+TGNP EDLKTQSL++QL+ Sbjct: 281 LELLYDRVLKYPDRVRNLYFTFLFVLRAVTKAADYLEQAEYDTGNPQEDLKTQSLVRQLV 340 Query: 181 YNPKLQAACPVPFDEAK 231 YNPKLQAACP+PFDEAK Sbjct: 341 YNPKLQAACPLPFDEAK 357 >ref|XP_019415786.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Lupinus angustifolius] ref|XP_019415787.1| PREDICTED: endoplasmic reticulum oxidoreductin-1-like [Lupinus angustifolius] gb|OIV98308.1| hypothetical protein TanjilG_16635 [Lupinus angustifolius] Length = 455 Score = 141 bits (355), Expect = 3e-38 Identities = 69/77 (89%), Positives = 73/77 (94%) Frame = +1 Query: 1 LTLMYDRVLKYPDRGRNLYFTFLFVLRAVTKAADYLELAEYNTGNPNEDLKTQSLIKQLL 180 LTL+YDRVL+YPDR NLYFTFLFVLRAVTKAADYLE AEY+TGNP EDLKTQSL+KQLL Sbjct: 256 LTLLYDRVLQYPDRVGNLYFTFLFVLRAVTKAADYLEQAEYDTGNPIEDLKTQSLMKQLL 315 Query: 181 YNPKLQAACPVPFDEAK 231 YNPKLQAACPVPFDEAK Sbjct: 316 YNPKLQAACPVPFDEAK 332