BLASTX nr result
ID: Astragalus24_contig00029730
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029730 (358 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004490716.1| PREDICTED: B3 domain-containing protein Os07... 62 8e-09 ref|XP_003616034.2| B3 domain transcription repressor VAL2 [Medi... 59 2e-07 ref|XP_007146893.1| hypothetical protein PHAVU_006G079300g [Phas... 56 1e-06 ref|XP_006591264.2| PREDICTED: B3 domain-containing transcriptio... 55 4e-06 gb|KHN24735.1| B3 domain-containing transcription repressor VAL1... 55 4e-06 ref|XP_017434874.1| PREDICTED: B3 domain-containing transcriptio... 54 7e-06 gb|KOM52722.1| hypothetical protein LR48_Vigan09g138100 [Vigna a... 54 7e-06 >ref|XP_004490716.1| PREDICTED: B3 domain-containing protein Os07g0679700-like [Cicer arietinum] Length = 779 Score = 62.4 bits (150), Expect = 8e-09 Identities = 34/58 (58%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = +2 Query: 5 DTN-EASREDTSQSQKERRQNRGRSEVAEQSAAGKIDLNSHPNHEYMEVD--DRTEHD 169 DTN +ASRED S S E N G+ E +E S AG+IDLN HPNHE ME+D +RTEH+ Sbjct: 721 DTNGDASREDASHSPDEVSVNGGQLEASEPSGAGQIDLNCHPNHEDMEMDTYNRTEHE 778 >ref|XP_003616034.2| B3 domain transcription repressor VAL2 [Medicago truncatula] gb|AES98992.2| B3 domain transcription repressor VAL2 [Medicago truncatula] Length = 786 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/53 (56%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = +2 Query: 17 ASREDTSQSQKERRQNRGRSEVAEQSAAGKIDLNSHPNHEYMEVD--DRTEHD 169 ASR+DTS S E N G+ EV E SAAG++DLN HP+HE ME D +R +HD Sbjct: 734 ASRQDTSHSTDEGSLNGGQLEVVEPSAAGQLDLNCHPSHEEMETDTYNRPKHD 786 >ref|XP_007146893.1| hypothetical protein PHAVU_006G079300g [Phaseolus vulgaris] ref|XP_007146894.1| hypothetical protein PHAVU_006G079300g [Phaseolus vulgaris] gb|ESW18887.1| hypothetical protein PHAVU_006G079300g [Phaseolus vulgaris] gb|ESW18888.1| hypothetical protein PHAVU_006G079300g [Phaseolus vulgaris] Length = 911 Score = 56.2 bits (134), Expect = 1e-06 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +2 Query: 5 DTNEASREDTSQSQKER-RQNRGRSEVAEQSAAGKIDLNSHPNHEYMEVD 151 DTNE SR+D +Q +KE +R ++E E SAAG+IDLNSHPN E M+VD Sbjct: 780 DTNETSRDDATQLEKEVVGLSRSQAEGGESSAAGQIDLNSHPNREDMQVD 829 >ref|XP_006591264.2| PREDICTED: B3 domain-containing transcription repressor VAL1-like [Glycine max] ref|XP_014619648.1| PREDICTED: B3 domain-containing transcription repressor VAL1-like [Glycine max] ref|XP_014619649.1| PREDICTED: B3 domain-containing transcription repressor VAL1-like [Glycine max] ref|XP_014619650.1| PREDICTED: B3 domain-containing transcription repressor VAL1-like [Glycine max] gb|KRH30645.1| hypothetical protein GLYMA_11G197900 [Glycine max] gb|KRH30646.1| hypothetical protein GLYMA_11G197900 [Glycine max] Length = 911 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +2 Query: 2 PDTNEASREDTSQSQKERRQNRGRSEVAEQSAAGKIDLNSHPNHEYMEVD 151 PDTN A R+DTS+ +KE N+ + +V E S+ G+IDLNSHPN E M+V+ Sbjct: 775 PDTNGAPRDDTSRLEKEVGLNKSQHQVGE-SSTGQIDLNSHPNREDMQVE 823 >gb|KHN24735.1| B3 domain-containing transcription repressor VAL1 [Glycine soja] Length = 911 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +2 Query: 2 PDTNEASREDTSQSQKERRQNRGRSEVAEQSAAGKIDLNSHPNHEYMEVD 151 PDTN A R+DTS+ +KE N+ + +V E S+ G+IDLNSHPN E M+V+ Sbjct: 775 PDTNGAPRDDTSRLEKEVGLNKSQHQVGE-SSTGQIDLNSHPNREDMQVE 823 >ref|XP_017434874.1| PREDICTED: B3 domain-containing transcription repressor VAL1 [Vigna angularis] ref|XP_017434875.1| PREDICTED: B3 domain-containing transcription repressor VAL1 [Vigna angularis] ref|XP_017434876.1| PREDICTED: B3 domain-containing transcription repressor VAL1 [Vigna angularis] ref|XP_017434877.1| PREDICTED: B3 domain-containing transcription repressor VAL1 [Vigna angularis] dbj|BAT88224.1| hypothetical protein VIGAN_05167200 [Vigna angularis var. angularis] Length = 912 Score = 53.9 bits (128), Expect = 7e-06 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +2 Query: 5 DTNEASREDTSQSQKER-RQNRGRSEVAEQSAAGKIDLNSHPNHEYMEVD 151 DTNE SR+D +Q +KE +R ++EV E SAAG+IDLNS PN E M VD Sbjct: 779 DTNETSRDDATQLEKEVVGLSRSQAEVGESSAAGQIDLNSDPNREDMVVD 828 >gb|KOM52722.1| hypothetical protein LR48_Vigan09g138100 [Vigna angularis] Length = 921 Score = 53.9 bits (128), Expect = 7e-06 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +2 Query: 5 DTNEASREDTSQSQKER-RQNRGRSEVAEQSAAGKIDLNSHPNHEYMEVD 151 DTNE SR+D +Q +KE +R ++EV E SAAG+IDLNS PN E M VD Sbjct: 788 DTNETSRDDATQLEKEVVGLSRSQAEVGESSAAGQIDLNSDPNREDMVVD 837