BLASTX nr result
ID: Astragalus24_contig00029729
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029729 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX56788.1| Ulp1 protease family C-terminal catalytic domain ... 63 4e-10 >gb|PNX56788.1| Ulp1 protease family C-terminal catalytic domain containing protein, partial [Trifolium pratense] Length = 136 Score = 63.2 bits (152), Expect = 4e-10 Identities = 30/59 (50%), Positives = 43/59 (72%), Gaps = 2/59 (3%) Frame = +3 Query: 102 NVSHSDQMMYQCQMD--HKFNLKRV*LWTLQEEEYVSSLVIDSWANMLNFSQRNDKLIR 272 ++SH + + C + H F+L+R LWTLQ++E+VS VI+SWAN LN+SQRNDK+ R Sbjct: 26 SISHDETEILYCSDNKAHAFSLQRSDLWTLQKDEWVSCFVINSWANCLNWSQRNDKVTR 84