BLASTX nr result
ID: Astragalus24_contig00029714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029714 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX55485.1| hypothetical protein L195_g049114, partial [Trifo... 96 4e-23 ref|XP_012573556.1| PREDICTED: pentatricopeptide repeat-containi... 98 7e-21 gb|PNX71134.1| pentatricopeptide repeat-containing protein [Trif... 96 2e-20 dbj|GAU46119.1| hypothetical protein TSUD_192790 [Trifolium subt... 95 8e-20 ref|XP_013457922.1| PPR containing plant-like protein [Medicago ... 93 3e-19 gb|KDO55500.1| hypothetical protein CISIN_1g0449882mg, partial [... 79 2e-15 gb|KRH03506.1| hypothetical protein GLYMA_17G101900 [Glycine max] 79 3e-14 gb|KHN18567.1| Pentatricopeptide repeat-containing protein [Glyc... 79 3e-14 ref|XP_003550788.2| PREDICTED: pentatricopeptide repeat-containi... 79 3e-14 dbj|GAY55294.1| hypothetical protein CUMW_163350 [Citrus unshiu] 79 3e-14 ref|XP_006477483.1| PREDICTED: pentatricopeptide repeat-containi... 79 3e-14 ref|XP_006440636.1| pentatricopeptide repeat-containing protein ... 79 3e-14 gb|OIW18505.1| hypothetical protein TanjilG_13257 [Lupinus angus... 77 9e-14 ref|XP_019451507.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-13 ref|XP_007155292.1| hypothetical protein PHAVU_003G188600g [Phas... 76 3e-13 ref|XP_020227571.1| pentatricopeptide repeat-containing protein ... 75 9e-13 ref|XP_016168005.1| pentatricopeptide repeat-containing protein ... 74 2e-12 emb|CBI15196.3| unnamed protein product, partial [Vitis vinifera] 73 3e-12 ref|XP_014506629.1| pentatricopeptide repeat-containing protein ... 73 3e-12 ref|XP_002281803.1| PREDICTED: pentatricopeptide repeat-containi... 73 3e-12 >gb|PNX55485.1| hypothetical protein L195_g049114, partial [Trifolium pratense] gb|PNX60698.1| PPR containing plant-like protein, partial [Trifolium pratense] Length = 101 Score = 96.3 bits (238), Expect = 4e-23 Identities = 43/57 (75%), Positives = 49/57 (85%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVEG 173 PGQSW QINGV+HNF D+THK SSLIYETLCEIT+QA +EGY+PDIT+ LDVEG Sbjct: 45 PGQSWTQINGVIHNFVVGDMTHKHSSLIYETLCEITEQARMEGYKPDITEILLDVEG 101 >ref|XP_012573556.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Cicer arietinum] ref|XP_012573557.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X2 [Cicer arietinum] ref|XP_012573558.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Cicer arietinum] ref|XP_012573559.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Cicer arietinum] Length = 548 Score = 97.8 bits (242), Expect = 7e-21 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVEG 173 PGQSWIQINGV+HNF D+THK SSLIYETLCEIT+QA +EGY+PDIT+ LDVEG Sbjct: 492 PGQSWIQINGVVHNFVVGDMTHKHSSLIYETLCEITEQARVEGYKPDITEVLLDVEG 548 >gb|PNX71134.1| pentatricopeptide repeat-containing protein [Trifolium pratense] Length = 464 Score = 96.3 bits (238), Expect = 2e-20 Identities = 43/57 (75%), Positives = 49/57 (85%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVEG 173 PGQSW QINGV+HNF D+THK SSLIYETLCEIT+QA +EGY+PDIT+ LDVEG Sbjct: 408 PGQSWTQINGVIHNFVVGDMTHKHSSLIYETLCEITEQARMEGYKPDITEILLDVEG 464 >dbj|GAU46119.1| hypothetical protein TSUD_192790 [Trifolium subterraneum] Length = 548 Score = 94.7 bits (234), Expect = 8e-20 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVEG 173 PGQSW QINGV+HNF D+THK SS IYETLCEIT+QA LEGY+PDIT+ LDVEG Sbjct: 492 PGQSWTQINGVVHNFVVGDMTHKHSSSIYETLCEITEQARLEGYKPDITEILLDVEG 548 >ref|XP_013457922.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH31953.1| PPR containing plant-like protein [Medicago truncatula] Length = 548 Score = 93.2 bits (230), Expect = 3e-19 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVEG 173 PGQSWIQI GV+HNF D+THK SSLIYETLCEIT+QA +EGY+PDIT+ LD EG Sbjct: 492 PGQSWIQIYGVVHNFVVGDMTHKHSSLIYETLCEITEQARVEGYKPDITEVLLDAEG 548 >gb|KDO55500.1| hypothetical protein CISIN_1g0449882mg, partial [Citrus sinensis] Length = 195 Score = 79.0 bits (193), Expect = 2e-15 Identities = 36/56 (64%), Positives = 46/56 (82%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 PGQSW+QINGV+H+F A D T+K +SLIY+TL EIT QA EGY+PDI++ FL +E Sbjct: 139 PGQSWVQINGVLHDFVAGDSTYKQASLIYKTLGEITMQAMQEGYKPDISELFLGIE 194 >gb|KRH03506.1| hypothetical protein GLYMA_17G101900 [Glycine max] Length = 478 Score = 79.0 bits (193), Expect = 3e-14 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 PG+SWIQINGV+HNF A D+THK SS IYETL ++TKQA+LEGY +I FLDVE Sbjct: 423 PGRSWIQINGVVHNFIAGDMTHKHSSFIYETLRDVTKQANLEGYDREIIV-FLDVE 477 >gb|KHN18567.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 549 Score = 79.0 bits (193), Expect = 3e-14 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 PG+SWIQINGV+HNF A D+THK SS IYETL ++TKQA+LEGY +I FLDVE Sbjct: 494 PGRSWIQINGVVHNFIAGDMTHKHSSFIYETLRDVTKQANLEGYDREIIV-FLDVE 548 >ref|XP_003550788.2| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] Length = 551 Score = 79.0 bits (193), Expect = 3e-14 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 PG+SWIQINGV+HNF A D+THK SS IYETL ++TKQA+LEGY +I FLDVE Sbjct: 496 PGRSWIQINGVVHNFIAGDMTHKHSSFIYETLRDVTKQANLEGYDREIIV-FLDVE 550 >dbj|GAY55294.1| hypothetical protein CUMW_163350 [Citrus unshiu] Length = 556 Score = 79.0 bits (193), Expect = 3e-14 Identities = 36/56 (64%), Positives = 46/56 (82%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 PGQSW+QINGV+H+F A D T+K +SLIY+TL EIT QA EGY+PDI++ FL +E Sbjct: 500 PGQSWVQINGVLHDFVAGDSTYKQASLIYKTLGEITMQAMREGYKPDISELFLGIE 555 >ref|XP_006477483.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] Length = 556 Score = 79.0 bits (193), Expect = 3e-14 Identities = 36/56 (64%), Positives = 46/56 (82%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 PGQSW+QINGV+H+F A D T+K +SLIY+TL EIT QA EGY+PDI++ FL +E Sbjct: 500 PGQSWVQINGVLHDFVAGDSTYKQASLIYKTLGEITMQAMREGYKPDISELFLGIE 555 >ref|XP_006440636.1| pentatricopeptide repeat-containing protein At5g66520 [Citrus clementina] gb|ESR53876.1| hypothetical protein CICLE_v10019550mg [Citrus clementina] Length = 556 Score = 79.0 bits (193), Expect = 3e-14 Identities = 36/56 (64%), Positives = 46/56 (82%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 PGQSW+QINGV+H+F A D T+K +SLIY+TL EIT QA EGY+PDI++ FL +E Sbjct: 500 PGQSWVQINGVLHDFVAGDSTYKQASLIYKTLGEITMQAMQEGYKPDISELFLGIE 555 >gb|OIW18505.1| hypothetical protein TanjilG_13257 [Lupinus angustifolius] Length = 457 Score = 77.4 bits (189), Expect = 9e-14 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDI 146 PG SWIQINGV+H+F A D+THK SS IYE L EITKQ H EGY PDI Sbjct: 393 PGHSWIQINGVVHDFVAGDMTHKHSSFIYEILYEITKQTHQEGYEPDI 440 >ref|XP_019451507.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Lupinus angustifolius] Length = 553 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDI 146 PG SWIQINGV+H+F A D+THK SS IYE L EITKQ H EGY PDI Sbjct: 489 PGHSWIQINGVVHDFVAGDMTHKHSSFIYEILYEITKQTHQEGYEPDI 536 >ref|XP_007155292.1| hypothetical protein PHAVU_003G188600g [Phaseolus vulgaris] gb|ESW27286.1| hypothetical protein PHAVU_003G188600g [Phaseolus vulgaris] Length = 550 Score = 75.9 bits (185), Expect = 3e-13 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 PG+SWIQINGV+HNF A D+THK S IYE L ++TKQA+LEGY +I FLD+E Sbjct: 495 PGRSWIQINGVVHNFVAGDMTHKHSHFIYEILYDVTKQANLEGYGSEINV-FLDIE 549 >ref|XP_020227571.1| pentatricopeptide repeat-containing protein At5g56310-like [Cajanus cajan] Length = 553 Score = 74.7 bits (182), Expect = 9e-13 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 PG+SWIQI G +HNF A D+THK SS IYE L +ITKQA+LE Y P+I FLDVE Sbjct: 498 PGRSWIQIYGAVHNFVAGDMTHKHSSFIYEILRDITKQANLEAYEPEI-NIFLDVE 552 >ref|XP_016168005.1| pentatricopeptide repeat-containing protein At5g56310-like [Arachis ipaensis] Length = 562 Score = 73.6 bits (179), Expect = 2e-12 Identities = 35/54 (64%), Positives = 42/54 (77%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLD 164 PG+S +QINGV+HNF A D+THK S IYETL EITKQA+ E Y PDIT+ +D Sbjct: 508 PGRSVVQINGVLHNFVAGDVTHKHSYYIYETLHEITKQANWEDYEPDITEVLVD 561 >emb|CBI15196.3| unnamed protein product, partial [Vitis vinifera] Length = 467 Score = 73.2 bits (178), Expect = 3e-12 Identities = 33/55 (60%), Positives = 44/55 (80%) Frame = +3 Query: 6 GQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 G+SW+QINGV+H+F A D THK +S +YE L +IT+QA LEGY+ DI++ LDVE Sbjct: 413 GRSWVQINGVVHDFVAGDWTHKHASSVYEMLSKITRQAKLEGYKLDISEVLLDVE 467 >ref|XP_014506629.1| pentatricopeptide repeat-containing protein At5g66520 [Vigna radiata var. radiata] Length = 545 Score = 73.2 bits (178), Expect = 3e-12 Identities = 35/56 (62%), Positives = 42/56 (75%) Frame = +3 Query: 3 PGQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 PG+SWIQING +HNF A D+THK S IYE L ++TKQA+LEGY I FLD+E Sbjct: 490 PGRSWIQINGAVHNFVAGDITHKHSYFIYEILYDVTKQANLEGYESKI-NIFLDIE 544 >ref|XP_002281803.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 553 Score = 73.2 bits (178), Expect = 3e-12 Identities = 33/55 (60%), Positives = 44/55 (80%) Frame = +3 Query: 6 GQSWIQINGVMHNFGASDLTHKDSSLIYETLCEITKQAHLEGYRPDITQDFLDVE 170 G+SW+QINGV+H+F A D THK +S +YE L +IT+QA LEGY+ DI++ LDVE Sbjct: 499 GRSWVQINGVVHDFVAGDWTHKHASSVYEMLSKITRQAKLEGYKLDISEVLLDVE 553