BLASTX nr result
ID: Astragalus24_contig00029516
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029516 (335 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007150091.1| hypothetical protein PHAVU_005G125800g [Phas... 56 1e-06 >ref|XP_007150091.1| hypothetical protein PHAVU_005G125800g [Phaseolus vulgaris] gb|ESW22085.1| hypothetical protein PHAVU_005G125800g [Phaseolus vulgaris] Length = 864 Score = 55.8 bits (133), Expect = 1e-06 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 8/104 (7%) Frame = +2 Query: 5 VDLSAFSEGSHLGKDSKLGFSQAQLSQEIVTDLLSDCSPGNKVNGLGKVPEPHFEEVRVS 184 VD SE LG S LG S+ QL+QE+ +++CS G + + LG++ + F++V V Sbjct: 201 VDFCKGSEFVDLGMGSVLGLSEVQLTQEMG---VNECSHGARRDVLGEIRDGRFDKVAVF 257 Query: 185 EREISDLGESPLKKLKPLEQNFG--------KLVSDAVRESVEN 292 +RE+S++ ESP KK K E + G ++ S V+E V N Sbjct: 258 DRELSEMDESPGKKPKLSEGDLGIDSSGGCVEVQSQKVKEGVGN 301