BLASTX nr result
ID: Astragalus24_contig00029503
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029503 (377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN17724.1| Pentatricopeptide repeat-containing protein [Glyc... 67 2e-10 ref|XP_014625434.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-10 >gb|KHN17724.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 544 Score = 67.4 bits (163), Expect = 2e-10 Identities = 43/77 (55%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = -3 Query: 231 PHGVAKHITSLSSFFTTIRLSHYRTLPPPS-HNKPLITLTPQHWFVKIISTLFLLRTSSN 55 P+GV K +T SFFT IR SHYRTL + +K LI TP WFVKI+STLFL SN Sbjct: 5 PYGVEKLMTF--SFFTAIRASHYRTLTQATASDKGLIITTPDSWFVKIVSTLFL---CSN 59 Query: 54 SLSDPPFLSYLTNNLTP 4 SL D FL Y +LTP Sbjct: 60 SLDD-RFLGYFREHLTP 75 >ref|XP_014625434.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Glycine max] gb|KRH02605.1| hypothetical protein GLYMA_17G049100 [Glycine max] Length = 544 Score = 67.4 bits (163), Expect = 2e-10 Identities = 43/77 (55%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = -3 Query: 231 PHGVAKHITSLSSFFTTIRLSHYRTLPPPS-HNKPLITLTPQHWFVKIISTLFLLRTSSN 55 P+GV K +T SFFT IR SHYRTL + +K LI TP WFVKI+STLFL SN Sbjct: 5 PYGVEKLMTF--SFFTAIRASHYRTLTQATASDKGLIITTPDSWFVKIVSTLFL---CSN 59 Query: 54 SLSDPPFLSYLTNNLTP 4 SL D FL Y +LTP Sbjct: 60 SLDD-RFLGYFREHLTP 75