BLASTX nr result
ID: Astragalus24_contig00029470
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029470 (694 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY17164.1| hypothetical protein L195_g013902 [Trifolium prat... 60 7e-07 >gb|PNY17164.1| hypothetical protein L195_g013902 [Trifolium pratense] Length = 875 Score = 60.5 bits (145), Expect = 7e-07 Identities = 29/48 (60%), Positives = 32/48 (66%) Frame = -2 Query: 255 HHHAINKNQKDITLKS*RNHHK*SNGGGENEAGLVKYMPNLPGYYLEG 112 HHH I+KN +D TLKS RNHHK N G E E +VKYM NLP Y G Sbjct: 23 HHHEIHKNDEDRTLKSYRNHHKQGNYGREYEDEMVKYMSNLPSYLQRG 70