BLASTX nr result
ID: Astragalus24_contig00029452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029452 (319 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK48917.1| unknown [Lotus japonicus] 100 7e-24 gb|AFK40539.1| unknown [Lotus japonicus] 100 7e-24 sp|Q40195.1|RB11E_LOTJA RecName: Full=Ras-related protein Rab11E... 100 7e-24 ref|XP_004505464.1| PREDICTED: ras-related protein Rab11D-like [... 97 7e-23 ref|XP_015881317.1| PREDICTED: ras-related protein Rab11D [Zizip... 95 6e-22 gb|ABF70059.1| GTP-binding protein, putative [Musa acuminata] 94 8e-22 ref|XP_012452171.1| PREDICTED: ras-related protein RABA1c-like [... 94 9e-22 gb|OMO76340.1| Small GTPase superfamily [Corchorus capsularis] 93 1e-21 gb|AQL04061.1| Ras-related protein RABA1d [Zea mays] 92 1e-21 gb|OMO76158.1| Small GTPase superfamily [Corchorus capsularis] 93 1e-21 gb|OMO65446.1| Small GTPase superfamily [Corchorus olitorius] 93 1e-21 ref|XP_018857123.1| PREDICTED: ras-related protein Rab11D [Jugla... 94 1e-21 ref|XP_022898711.1| ras-related protein RABA1d-like [Olea europa... 94 1e-21 gb|OWM78732.1| hypothetical protein CDL15_Pgr002903 [Punica gran... 94 2e-21 ref|XP_022720367.1| ras-related protein RABA1c-like [Durio zibet... 94 2e-21 ref|XP_009351563.1| PREDICTED: ras-related protein RIC2 [Pyrus x... 94 2e-21 ref|XP_008371501.1| PREDICTED: ras-related protein RIC2 [Malus d... 94 2e-21 ref|XP_009352730.1| PREDICTED: ras-related protein RIC2-like [Py... 94 2e-21 ref|XP_008383607.1| PREDICTED: ras-related protein RIC2 [Malus d... 94 2e-21 ref|XP_007212032.1| ras-related protein RIC2 [Prunus persica] >g... 94 2e-21 >gb|AFK48917.1| unknown [Lotus japonicus] Length = 218 Score = 100 bits (248), Expect = 7e-24 Identities = 49/63 (77%), Positives = 54/63 (85%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQHC 106 RYRAITSAYYRGAVGALLVYDVTRSTTFET GRWLKELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRSTTFETAGRWLKELRDHTDPNIVVMLIGNKSDLRHL 133 Query: 105 KTM 97 T+ Sbjct: 134 VTV 136 >gb|AFK40539.1| unknown [Lotus japonicus] Length = 218 Score = 100 bits (248), Expect = 7e-24 Identities = 49/63 (77%), Positives = 54/63 (85%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQHC 106 RYRAITSAYYRGAVGALLVYDVTRSTTFET GRWLKELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRSTTFETAGRWLKELRDHTDPNIVVMLIGNKSDLRHL 133 Query: 105 KTM 97 T+ Sbjct: 134 VTV 136 >sp|Q40195.1|RB11E_LOTJA RecName: Full=Ras-related protein Rab11E emb|CAA98181.1| RAB11E [Lotus japonicus] Length = 218 Score = 100 bits (248), Expect = 7e-24 Identities = 49/63 (77%), Positives = 54/63 (85%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQHC 106 RYRAITSAYYRGAVGALLVYDVTRSTTFET GRWLKELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRSTTFETAGRWLKELRDHTDPNIVVMLIGNKSDLRHL 133 Query: 105 KTM 97 T+ Sbjct: 134 VTV 136 >ref|XP_004505464.1| PREDICTED: ras-related protein Rab11D-like [Cicer arietinum] Length = 218 Score = 97.4 bits (241), Expect = 7e-23 Identities = 47/59 (79%), Positives = 52/59 (88%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTRS+TFET GRWLKELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRSSTFETAGRWLKELRDHTDPNIVVMLIGNKSDLRH 132 >ref|XP_015881317.1| PREDICTED: ras-related protein Rab11D [Ziziphus jujuba] Length = 218 Score = 95.1 bits (235), Expect = 6e-22 Identities = 46/59 (77%), Positives = 51/59 (86%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR +TFE VGRWLKELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRRSTFENVGRWLKELRDHTDPNIVVMLIGNKSDLRH 132 >gb|ABF70059.1| GTP-binding protein, putative [Musa acuminata] Length = 175 Score = 93.6 bits (231), Expect = 8e-22 Identities = 46/62 (74%), Positives = 52/62 (83%) Frame = -2 Query: 294 NCNRYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFL 115 NC RYRAITSAYYRGAVGALLVYDVTR TTFE V RWL+ELRDHTDPNI+ + + + L Sbjct: 28 NC-RYRAITSAYYRGAVGALLVYDVTRHTTFENVSRWLRELRDHTDPNIIIMLIGNKSDL 86 Query: 114 QH 109 +H Sbjct: 87 RH 88 >ref|XP_012452171.1| PREDICTED: ras-related protein RABA1c-like [Gossypium raimondii] gb|KJB68368.1| hypothetical protein B456_010G241300 [Gossypium raimondii] Length = 177 Score = 93.6 bits (231), Expect = 9e-22 Identities = 45/62 (72%), Positives = 52/62 (83%) Frame = -2 Query: 294 NCNRYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFL 115 + NRYRAITSAYYRGAVGALLVYDVTR +TFE V RWL+ELRDHTDPNIV + + + L Sbjct: 30 HANRYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNKSDL 89 Query: 114 QH 109 +H Sbjct: 90 RH 91 >gb|OMO76340.1| Small GTPase superfamily [Corchorus capsularis] Length = 153 Score = 92.8 bits (229), Expect = 1e-21 Identities = 46/70 (65%), Positives = 52/70 (74%) Frame = -2 Query: 306 LELSNCNRYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPS 127 L + C RYRAITSAYYRGAVGALLVYDVTR TFE V RWLKELRDHTD NIV + + Sbjct: 3 LSIVFCQRYRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVIMLVGN 62 Query: 126 MTFLQHCKTM 97 L+H + + Sbjct: 63 KADLRHLRAV 72 >gb|AQL04061.1| Ras-related protein RABA1d [Zea mays] Length = 144 Score = 92.4 bits (228), Expect = 1e-21 Identities = 45/59 (76%), Positives = 50/59 (84%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR +TFE V RWLKELRDHTDPNIV + + + L+H Sbjct: 2 RYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLKELRDHTDPNIVVMLVGNKSDLRH 60 >gb|OMO76158.1| Small GTPase superfamily [Corchorus capsularis] Length = 172 Score = 93.2 bits (230), Expect = 1e-21 Identities = 46/65 (70%), Positives = 53/65 (81%) Frame = -2 Query: 303 ELSNCNRYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSM 124 EL + N YRAITSAYYRGAVGALLVYDVTR +TFE V RWL+ELRDHTDPNIV + + Sbjct: 22 ELKSRNLYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNK 81 Query: 123 TFLQH 109 + L+H Sbjct: 82 SDLRH 86 >gb|OMO65446.1| Small GTPase superfamily [Corchorus olitorius] Length = 172 Score = 93.2 bits (230), Expect = 1e-21 Identities = 46/65 (70%), Positives = 53/65 (81%) Frame = -2 Query: 303 ELSNCNRYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSM 124 EL + N YRAITSAYYRGAVGALLVYDVTR +TFE V RWL+ELRDHTDPNIV + + Sbjct: 22 ELKSRNLYRAITSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLIGNK 81 Query: 123 TFLQH 109 + L+H Sbjct: 82 SDLRH 86 >ref|XP_018857123.1| PREDICTED: ras-related protein Rab11D [Juglans regia] Length = 217 Score = 94.4 bits (233), Expect = 1e-21 Identities = 45/59 (76%), Positives = 51/59 (86%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR TTFE VGRWLKELR+HTDPN+V + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRHTTFENVGRWLKELREHTDPNLVVMLIGNKSDLRH 132 >ref|XP_022898711.1| ras-related protein RABA1d-like [Olea europaea var. sylvestris] Length = 218 Score = 94.4 bits (233), Expect = 1e-21 Identities = 45/59 (76%), Positives = 51/59 (86%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR+ TFE VGRWL+ELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRNPTFENVGRWLRELRDHTDPNIVVMLVGNKSDLRH 132 >gb|OWM78732.1| hypothetical protein CDL15_Pgr002903 [Punica granatum] gb|PKI44019.1| hypothetical protein CRG98_035604 [Punica granatum] Length = 218 Score = 94.0 bits (232), Expect = 2e-21 Identities = 45/59 (76%), Positives = 51/59 (86%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR +TFE VGRWLKELRDHTDPN+V + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRRSTFENVGRWLKELRDHTDPNMVVMLIGNKSDLRH 132 >ref|XP_022720367.1| ras-related protein RABA1c-like [Durio zibethinus] Length = 220 Score = 94.0 bits (232), Expect = 2e-21 Identities = 45/59 (76%), Positives = 51/59 (86%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR +TFE VGRWL+ELRDHTDPNIV + + + L+H Sbjct: 76 RYRAITSAYYRGAVGALLVYDVTRHSTFENVGRWLRELRDHTDPNIVVMLIGNKSDLRH 134 >ref|XP_009351563.1| PREDICTED: ras-related protein RIC2 [Pyrus x bretschneideri] Length = 216 Score = 93.6 bits (231), Expect = 2e-21 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR++TFE+V RWLKELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRNSTFESVERWLKELRDHTDPNIVVMLVGNKSDLRH 132 >ref|XP_008371501.1| PREDICTED: ras-related protein RIC2 [Malus domestica] Length = 216 Score = 93.6 bits (231), Expect = 2e-21 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR++TFE+V RWLKELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRNSTFESVERWLKELRDHTDPNIVVMLVGNKSDLRH 132 >ref|XP_009352730.1| PREDICTED: ras-related protein RIC2-like [Pyrus x bretschneideri] Length = 217 Score = 93.6 bits (231), Expect = 2e-21 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR++TFE+V RWLKELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRNSTFESVERWLKELRDHTDPNIVVMLVGNKSDLRH 132 >ref|XP_008383607.1| PREDICTED: ras-related protein RIC2 [Malus domestica] Length = 217 Score = 93.6 bits (231), Expect = 2e-21 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR++TFE+V RWLKELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRNSTFESVERWLKELRDHTDPNIVVMLVGNKSDLRH 132 >ref|XP_007212032.1| ras-related protein RIC2 [Prunus persica] ref|XP_008225224.1| PREDICTED: ras-related protein RIC2 [Prunus mume] ref|XP_021813178.1| ras-related protein RIC2 [Prunus avium] gb|ONI10756.1| hypothetical protein PRUPE_4G066500 [Prunus persica] Length = 218 Score = 93.6 bits (231), Expect = 2e-21 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = -2 Query: 285 RYRAITSAYYRGAVGALLVYDVTRSTTFETVGRWLKELRDHTDPNIVAVPEPSMTFLQH 109 RYRAITSAYYRGAVGALLVYDVTR++TFE+V RWLKELRDHTDPNIV + + + L+H Sbjct: 74 RYRAITSAYYRGAVGALLVYDVTRNSTFESVERWLKELRDHTDPNIVVMLVGNKSDLRH 132