BLASTX nr result
ID: Astragalus24_contig00029422
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029422 (355 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013453464.1| hypothetical protein MTR_5g015205 [Medicago ... 72 7e-14 >ref|XP_013453464.1| hypothetical protein MTR_5g015205 [Medicago truncatula] gb|KEH27495.1| hypothetical protein MTR_5g015205 [Medicago truncatula] Length = 97 Score = 71.6 bits (174), Expect = 7e-14 Identities = 36/43 (83%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = -2 Query: 333 LEASKEEEDTMKVKAWSKATPQKLQLKLQAPSSLC-DCSPNKY 208 L+ SKEEEDTMKV+AWSKATPQ+LQLKLQAPS LC D SPNKY Sbjct: 47 LKRSKEEEDTMKVRAWSKATPQQLQLKLQAPSLLCDDHSPNKY 89