BLASTX nr result
ID: Astragalus24_contig00029381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029381 (635 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494397.1| PREDICTED: ethylene response sensor 1 [Cicer... 76 2e-12 gb|PNY13998.1| ethylene receptor-like protein, partial [Trifoliu... 71 9e-11 ref|XP_003625933.2| ethylene receptor [Medicago truncatula] >gi|... 71 1e-10 dbj|GAU11255.1| hypothetical protein TSUD_342460 [Trifolium subt... 70 2e-10 ref|XP_020231725.1| ethylene response sensor 1 [Cajanus cajan] >... 70 2e-10 gb|AAB94773.1| ERS-like ethylene receptor [Pisum sativum] 70 2e-10 emb|CAA06723.1| ethylene receptor [Pisum sativum] 70 2e-10 ref|XP_003521577.1| PREDICTED: ethylene response sensor 1-like [... 68 1e-09 ref|XP_007163147.1| hypothetical protein PHAVU_001G210200g [Phas... 67 2e-09 ref|XP_006604726.1| PREDICTED: ethylene response sensor 1-like [... 65 8e-09 ref|XP_022634661.1| ethylene response sensor 1 isoform X1 [Vigna... 65 2e-08 gb|ABP87899.1| ethylene receptor [Glycine max] 65 2e-08 ref|NP_001304213.1| ethylene response sensor 1 [Vigna radiata] >... 65 2e-08 ref|XP_015968969.1| ethylene response sensor 1 [Arachis duranensis] 63 5e-08 ref|XP_017418612.1| PREDICTED: ethylene response sensor 1-like [... 63 5e-08 ref|XP_016205224.1| ethylene response sensor 1 [Arachis ipaensis] 63 7e-08 ref|XP_019452375.1| PREDICTED: probable ethylene response sensor... 60 4e-07 ref|XP_019452374.1| PREDICTED: probable ethylene response sensor... 60 4e-07 ref|XP_018824791.1| PREDICTED: probable ethylene response sensor... 57 5e-06 >ref|XP_004494397.1| PREDICTED: ethylene response sensor 1 [Cicer arietinum] ref|XP_004494398.1| PREDICTED: ethylene response sensor 1 [Cicer arietinum] Length = 636 Score = 75.9 bits (185), Expect = 2e-12 Identities = 38/61 (62%), Positives = 45/61 (73%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IWMES GH KGS A +VK GIC NP+S HQAA +G AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWMESEGHDKGSTATFIVKLGICGNPDSSDHQAARRGQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >gb|PNY13998.1| ethylene receptor-like protein, partial [Trifolium pratense] Length = 703 Score = 71.2 bits (173), Expect = 9e-11 Identities = 35/61 (57%), Positives = 45/61 (73%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IWMES GH KGS A +VK GIC NP++ HQA+++ AY+GSGGLA+ Sbjct: 583 KRFVNL-MGGHIWMESEGHDKGSTATFVVKLGICGNPDASDHQASSRSQAYSGSGGLARF 641 Query: 550 K 552 K Sbjct: 642 K 642 >ref|XP_003625933.2| ethylene receptor [Medicago truncatula] gb|AES82151.2| ethylene receptor [Medicago truncatula] Length = 635 Score = 70.9 bits (172), Expect = 1e-10 Identities = 36/61 (59%), Positives = 44/61 (72%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IWMES GH KGS A +VK GIC N + HQAA++G AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWMESEGHDKGSTATFVVKLGICGNADPSDHQAASRGQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >dbj|GAU11255.1| hypothetical protein TSUD_342460 [Trifolium subterraneum] Length = 635 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/61 (57%), Positives = 44/61 (72%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IWMES GH KGS A +VK GIC NP++ HQAA++ Y+GSGGLA+ Sbjct: 556 KRFVNL-MGGHIWMESEGHDKGSTATFVVKLGICGNPDASDHQAASRSQIYSGSGGLARF 614 Query: 550 K 552 K Sbjct: 615 K 615 >ref|XP_020231725.1| ethylene response sensor 1 [Cajanus cajan] gb|KYP50981.1| Ethylene receptor [Cajanus cajan] Length = 636 Score = 70.5 bits (171), Expect = 2e-10 Identities = 36/61 (59%), Positives = 44/61 (72%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IW+ES G KGS A +VK GIC NP+ HQAAN+G AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWIESEGLDKGSTATFIVKLGICGNPDPSDHQAANRGQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >gb|AAB94773.1| ERS-like ethylene receptor [Pisum sativum] Length = 635 Score = 70.1 bits (170), Expect = 2e-10 Identities = 36/61 (59%), Positives = 43/61 (70%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IWMES G KGS A +VK GIC NP+S HQA +G AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWMESEGPDKGSTATFVVKLGICGNPDSSDHQATTRGQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >emb|CAA06723.1| ethylene receptor [Pisum sativum] Length = 635 Score = 70.1 bits (170), Expect = 2e-10 Identities = 36/61 (59%), Positives = 43/61 (70%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IWMES G KGS A +VK GIC NP+S HQA +G AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWMESEGPDKGSTATFVVKLGICGNPDSSDHQATTRGQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >ref|XP_003521577.1| PREDICTED: ethylene response sensor 1-like [Glycine max] gb|KHN20383.1| Ethylene response sensor 1 [Glycine soja] gb|KRH68220.1| hypothetical protein GLYMA_03G216700 [Glycine max] Length = 636 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/61 (57%), Positives = 43/61 (70%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IW+ES G KGS A +VK GIC NP+ HQAAN+ AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWIESEGLDKGSTATFIVKLGICGNPDPSDHQAANRSQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >ref|XP_007163147.1| hypothetical protein PHAVU_001G210200g [Phaseolus vulgaris] gb|ESW35141.1| hypothetical protein PHAVU_001G210200g [Phaseolus vulgaris] Length = 636 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/61 (55%), Positives = 42/61 (68%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IW+ES G KGS A +VK GIC NP+ HQA N+ AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWIESEGPGKGSTATFIVKLGICGNPDPSDHQATNRSQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >ref|XP_006604726.1| PREDICTED: ethylene response sensor 1-like [Glycine max] ref|XP_006604727.1| PREDICTED: ethylene response sensor 1-like [Glycine max] ref|XP_014627415.1| PREDICTED: ethylene response sensor 1-like [Glycine max] gb|KHN43489.1| Ethylene receptor [Glycine soja] gb|KRG96476.1| hypothetical protein GLYMA_19G213300 [Glycine max] gb|KRG96477.1| hypothetical protein GLYMA_19G213300 [Glycine max] Length = 636 Score = 65.5 bits (158), Expect = 8e-09 Identities = 45/135 (33%), Positives = 67/135 (49%), Gaps = 20/135 (14%) Frame = +1 Query: 208 RICITELQSLEGSWQPFIFSQLKCQQHTFFMLTF*YS----PIDELMNMFRNLASNWN-- 369 R+ + + +SL+ W+P F H + + S P E+ ++F A + + Sbjct: 484 RVSVAKPESLQ-DWRPPEFYPASSDGHFYIRVQVKDSGCGIPPQEIPHLFTKFAQSRSGP 542 Query: 370 --------------KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAAN 507 K+ NL +GG IW+ES G KGS A ++K IC NP+ HQAAN Sbjct: 543 ARPSSGAGLGLAICKRFVNL-MGGHIWIESEGPDKGSTATFIIKLEICGNPDPSDHQAAN 601 Query: 508 KG*AYNGSGGLAKSK 552 + AY+GSGGLA+ K Sbjct: 602 RSQAYSGSGGLARFK 616 >ref|XP_022634661.1| ethylene response sensor 1 isoform X1 [Vigna radiata var. radiata] ref|XP_022634662.1| ethylene response sensor 1 isoform X1 [Vigna radiata var. radiata] Length = 636 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IW+ES G KGS A +VK GIC NP+ HQA + AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWIESEGPGKGSTATFIVKLGICGNPDPSDHQATTRSQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >gb|ABP87899.1| ethylene receptor [Glycine max] Length = 636 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IW+ES G KGS A ++K IC NP+ HQAAN+ AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWIESEGLDKGSTATFIIKLEICGNPDPSDHQAANRSQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >ref|NP_001304213.1| ethylene response sensor 1 [Vigna radiata] gb|AAD03598.1| ethylene response sensor [Vigna radiata] Length = 636 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IW+ES G KGS A +VK GIC NP+ HQA + AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWIESEGPGKGSTATFIVKLGICGNPDPSDHQATTRSQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >ref|XP_015968969.1| ethylene response sensor 1 [Arachis duranensis] Length = 635 Score = 63.2 bits (152), Expect = 5e-08 Identities = 32/61 (52%), Positives = 43/61 (70%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IW+ES G KG+ A ++K GI NP+ + QAAN+G AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWIESEGMDKGTTATFIIKLGISGNPDLVDRQAANRGQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >ref|XP_017418612.1| PREDICTED: ethylene response sensor 1-like [Vigna angularis] ref|XP_017418613.1| PREDICTED: ethylene response sensor 1-like [Vigna angularis] gb|KOM39434.1| hypothetical protein LR48_Vigan03g281600 [Vigna angularis] dbj|BAT86280.1| hypothetical protein VIGAN_04391600 [Vigna angularis var. angularis] Length = 636 Score = 63.2 bits (152), Expect = 5e-08 Identities = 33/61 (54%), Positives = 41/61 (67%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IW+ES G KGS A +VK GI NP+ HQA N+ AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWIESEGPGKGSTATFIVKLGISGNPDPSDHQATNRSQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >ref|XP_016205224.1| ethylene response sensor 1 [Arachis ipaensis] Length = 635 Score = 62.8 bits (151), Expect = 7e-08 Identities = 32/61 (52%), Positives = 42/61 (68%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGLAKS 549 K+ NL +GG IW+ES G KG+ A ++K GI NP + QAAN+G AY+GSGGLA+ Sbjct: 557 KRFVNL-MGGHIWIESEGMDKGTTATFIIKLGISGNPELVDRQAANRGQAYSGSGGLARF 615 Query: 550 K 552 K Sbjct: 616 K 616 >ref|XP_019452375.1| PREDICTED: probable ethylene response sensor 1 isoform X2 [Lupinus angustifolius] gb|OIW07010.1| hypothetical protein TanjilG_02644 [Lupinus angustifolius] Length = 636 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/57 (52%), Positives = 37/57 (64%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGL 540 K+ NL +GG IW+ES G KGS +VK GIC NP GH+ N+G AY+GSG L Sbjct: 557 KRFVNL-MGGHIWIESEGLDKGSTTTFIVKLGICRNPELSGHRVPNRGQAYSGSGDL 612 >ref|XP_019452374.1| PREDICTED: probable ethylene response sensor 1 isoform X1 [Lupinus angustifolius] Length = 653 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/57 (52%), Positives = 37/57 (64%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENPNSLGHQAANKG*AYNGSGGL 540 K+ NL +GG IW+ES G KGS +VK GIC NP GH+ N+G AY+GSG L Sbjct: 574 KRFVNL-MGGHIWIESEGLDKGSTTTFIVKLGICRNPELSGHRVPNRGQAYSGSGDL 629 >ref|XP_018824791.1| PREDICTED: probable ethylene response sensor 1 [Juglans regia] ref|XP_018824792.1| PREDICTED: probable ethylene response sensor 1 [Juglans regia] Length = 636 Score = 57.4 bits (137), Expect = 5e-06 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Frame = +1 Query: 370 KKIQNLFVGGQIWMESTGHYKGSIAALLVKHGICENP-NSLGHQAANKG*AYNGSGGLAK 546 K+ NL +GG IW+ES G KGS AA +VK GIC+NP +S HQ A +G A+ GSG L Sbjct: 556 KRFVNL-MGGLIWLESEGLDKGSTAAFIVKLGICDNPSDSTMHQVAPRGRAHKGSGDLPG 614 Query: 547 SK 552 K Sbjct: 615 HK 616