BLASTX nr result
ID: Astragalus24_contig00029308
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029308 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019464252.1| PREDICTED: pentatricopeptide repeat-containi... 76 7e-13 gb|KHN11620.1| Pentatricopeptide repeat-containing protein [Glyc... 66 2e-09 ref|XP_003533536.1| PREDICTED: pentatricopeptide repeat-containi... 66 2e-09 ref|XP_016183008.1| pentatricopeptide repeat-containing protein ... 66 2e-09 ref|XP_020990815.1| pentatricopeptide repeat-containing protein ... 66 2e-09 ref|XP_004491818.1| PREDICTED: pentatricopeptide repeat-containi... 65 5e-09 gb|KHN13216.1| Pentatricopeptide repeat-containing protein [Glyc... 62 4e-08 ref|XP_020219893.1| pentatricopeptide repeat-containing protein ... 62 4e-08 ref|XP_006593678.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_003543853.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_017439896.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_003621254.1| pentatricopeptide (PPR) repeat protein [Medi... 60 1e-07 gb|KHN45507.1| Pentatricopeptide repeat-containing protein [Glyc... 59 4e-07 gb|KRG93547.1| hypothetical protein GLYMA_19G023400, partial [Gl... 59 4e-07 ref|XP_007151236.1| hypothetical protein PHAVU_004G029400g [Phas... 59 5e-07 ref|XP_011655117.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_015879393.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 emb|CBI36340.3| unnamed protein product, partial [Vitis vinifera] 58 1e-06 ref|XP_002265258.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_022144415.1| pentatricopeptide repeat-containing protein ... 58 1e-06 >ref|XP_019464252.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Lupinus angustifolius] gb|OIW17714.1| hypothetical protein TanjilG_29064 [Lupinus angustifolius] Length = 695 Score = 75.9 bits (185), Expect = 7e-13 Identities = 37/59 (62%), Positives = 46/59 (77%), Gaps = 4/59 (6%) Frame = -3 Query: 165 VVNLLKLSADAKWLHHGKSIHAQLVIHN----HSDITLLNSLIHFYVKCDQLHLSRILF 1 ++ LLK+SAD+KWL GK+IH QL+I N H+D T LNSLI+ YVKCDQLHL+R LF Sbjct: 19 LLKLLKISADSKWLRFGKTIHTQLLIRNQTSKHTDTTQLNSLINLYVKCDQLHLARKLF 77 >gb|KHN11620.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 694 Score = 65.9 bits (159), Expect = 2e-09 Identities = 34/56 (60%), Positives = 40/56 (71%), Gaps = 4/56 (7%) Frame = -3 Query: 156 LLKLSADAKWLHHGKSIHAQLVIHN----HSDITLLNSLIHFYVKCDQLHLSRILF 1 LLKL AD KWL GK++HAQ +I N HS I+ LNSL+H YVKC QL L+R LF Sbjct: 18 LLKLCADVKWLPFGKAMHAQFLIRNQTSNHSHISHLNSLVHLYVKCGQLGLARNLF 73 >ref|XP_003533536.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Glycine max] ref|XP_006587752.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Glycine max] gb|KRH40080.1| hypothetical protein GLYMA_09G236700 [Glycine max] Length = 694 Score = 65.9 bits (159), Expect = 2e-09 Identities = 34/56 (60%), Positives = 40/56 (71%), Gaps = 4/56 (7%) Frame = -3 Query: 156 LLKLSADAKWLHHGKSIHAQLVIHN----HSDITLLNSLIHFYVKCDQLHLSRILF 1 LLKL AD KWL GK++HAQ +I N HS I+ LNSL+H YVKC QL L+R LF Sbjct: 18 LLKLCADVKWLPFGKAMHAQFLIRNQTSNHSHISHLNSLVHLYVKCGQLGLARNLF 73 >ref|XP_016183008.1| pentatricopeptide repeat-containing protein At5g39680 [Arachis ipaensis] Length = 701 Score = 65.9 bits (159), Expect = 2e-09 Identities = 37/68 (54%), Positives = 46/68 (67%), Gaps = 4/68 (5%) Frame = -3 Query: 192 QSMMLKVASVVNLLKLSADAKWLHHGKSIHAQLVIHN----HSDITLLNSLIHFYVKCDQ 25 Q + + +V LLKLSAD+K L GKSIHAQL+I N H+ I +NSLI+FYVKC Sbjct: 11 QQFVPSLEDIVKLLKLSADSKCLPFGKSIHAQLLIRNQASHHTHIFQINSLINFYVKCGH 70 Query: 24 LHLSRILF 1 L L+R LF Sbjct: 71 LVLARKLF 78 >ref|XP_020990815.1| pentatricopeptide repeat-containing protein At5g39680 [Arachis duranensis] ref|XP_020990816.1| pentatricopeptide repeat-containing protein At5g39680 [Arachis duranensis] Length = 701 Score = 65.9 bits (159), Expect = 2e-09 Identities = 37/68 (54%), Positives = 46/68 (67%), Gaps = 4/68 (5%) Frame = -3 Query: 192 QSMMLKVASVVNLLKLSADAKWLHHGKSIHAQLVIHN----HSDITLLNSLIHFYVKCDQ 25 Q + + +V LLKLSAD+K L GKSIHAQL+I N H+ I +NSLI+FYVKC Sbjct: 11 QQFVPSLEDIVKLLKLSADSKCLPFGKSIHAQLLIRNQASHHTHIFQINSLINFYVKCGH 70 Query: 24 LHLSRILF 1 L L+R LF Sbjct: 71 LVLARKLF 78 >ref|XP_004491818.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Cicer arietinum] Length = 703 Score = 64.7 bits (156), Expect = 5e-09 Identities = 37/75 (49%), Positives = 47/75 (62%), Gaps = 6/75 (8%) Frame = -3 Query: 207 ILAFDQSMMLKVASVVNLLKLSADAKWLHHGKSIHAQLVIHNHSD------ITLLNSLIH 46 +LA + + + LLKLSADAK+L+ GK+IHAQ +I N S I LNSLI+ Sbjct: 1 MLALYSKHLPSLEELFKLLKLSADAKFLNFGKTIHAQFLIRNQSSNQHQSHIIQLNSLIN 60 Query: 45 FYVKCDQLHLSRILF 1 YVKC QL L+R LF Sbjct: 61 LYVKCSQLRLARYLF 75 >gb|KHN13216.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 689 Score = 62.0 bits (149), Expect = 4e-08 Identities = 35/65 (53%), Positives = 42/65 (64%), Gaps = 4/65 (6%) Frame = -3 Query: 183 MLKVASVVNLLKLSADAKWLHHGKSIHAQLVIHNH----SDITLLNSLIHFYVKCDQLHL 16 + + VVNLLK SA AK L GK+IHAQLV+ N SDIT +NSLI+ Y KC Q Sbjct: 6 LCSLKEVVNLLKFSATAKSLRFGKTIHAQLVVRNQTSKDSDITQINSLINLYSKCGQSKC 65 Query: 15 SRILF 1 +R LF Sbjct: 66 ARKLF 70 >ref|XP_020219893.1| pentatricopeptide repeat-containing protein At5g39680 [Cajanus cajan] ref|XP_020219894.1| pentatricopeptide repeat-containing protein At5g39680 [Cajanus cajan] Length = 697 Score = 62.0 bits (149), Expect = 4e-08 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 4/67 (5%) Frame = -3 Query: 189 SMMLKVASVVNLLKLSADAKWLHHGKSIHAQLVIHNH----SDITLLNSLIHFYVKCDQL 22 S++ + +V LLKL A+AK L GK++HAQ +I N S IT LNSLIH YVKC QL Sbjct: 10 SVLPSLEELVKLLKLCAEAKCLPFGKAMHAQFLIRNQTSSRSHITHLNSLIHLYVKCGQL 69 Query: 21 HLSRILF 1 L+R +F Sbjct: 70 GLARNVF 76 >ref|XP_006593678.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like isoform X2 [Glycine max] gb|KRH18468.1| hypothetical protein GLYMA_13G062300 [Glycine max] Length = 669 Score = 61.6 bits (148), Expect = 6e-08 Identities = 35/59 (59%), Positives = 40/59 (67%), Gaps = 4/59 (6%) Frame = -3 Query: 165 VVNLLKLSADAKWLHHGKSIHAQLVIHNH----SDITLLNSLIHFYVKCDQLHLSRILF 1 VVNLLK SA AK L GK+IHAQLV+ N SDIT +NSLI+ Y KC Q +R LF Sbjct: 26 VVNLLKFSATAKSLRFGKTIHAQLVVRNQTSKDSDITQINSLINLYSKCGQSKCARKLF 84 >ref|XP_003543853.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like isoform X1 [Glycine max] Length = 703 Score = 61.6 bits (148), Expect = 6e-08 Identities = 35/59 (59%), Positives = 40/59 (67%), Gaps = 4/59 (6%) Frame = -3 Query: 165 VVNLLKLSADAKWLHHGKSIHAQLVIHNH----SDITLLNSLIHFYVKCDQLHLSRILF 1 VVNLLK SA AK L GK+IHAQLV+ N SDIT +NSLI+ Y KC Q +R LF Sbjct: 26 VVNLLKFSATAKSLRFGKTIHAQLVVRNQTSKDSDITQINSLINLYSKCGQSKCARKLF 84 >ref|XP_017439896.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like isoform X1 [Vigna angularis] ref|XP_017439897.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like isoform X1 [Vigna angularis] ref|XP_017439898.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like isoform X1 [Vigna angularis] ref|XP_017439899.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like isoform X1 [Vigna angularis] dbj|BAU01251.1| hypothetical protein VIGAN_11044500 [Vigna angularis var. angularis] Length = 696 Score = 60.8 bits (146), Expect = 1e-07 Identities = 34/63 (53%), Positives = 43/63 (68%), Gaps = 4/63 (6%) Frame = -3 Query: 177 KVASVVNLLKLSADAKWLHHGKSIHAQLVIHNH----SDITLLNSLIHFYVKCDQLHLSR 10 K +VN+LKLSA +K L GK+IHAQL++ N S ITL+NSLI+ Y KC QL +R Sbjct: 15 KFKELVNILKLSATSKSLRLGKTIHAQLLVCNQTSKDSSITLINSLINLYSKCGQLEYAR 74 Query: 9 ILF 1 LF Sbjct: 75 KLF 77 >ref|XP_003621254.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AES77472.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 700 Score = 60.5 bits (145), Expect = 1e-07 Identities = 35/78 (44%), Positives = 49/78 (62%), Gaps = 9/78 (11%) Frame = -3 Query: 207 ILAFDQSMMLKVASVVNLLKLSADAKWLHHGKSIHAQLVIHNHS---------DITLLNS 55 ++AF + + +++LLKLSA+ K L+ GKSIH QL+I N S +I LNS Sbjct: 1 MVAFYSRYLPSLEELLHLLKLSANTKNLNFGKSIHTQLLIRNQSSTHHSYREFNIIQLNS 60 Query: 54 LIHFYVKCDQLHLSRILF 1 LI+ YVKC +L L+R LF Sbjct: 61 LINLYVKCSKLRLARYLF 78 >gb|KHN45507.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 368 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/58 (56%), Positives = 40/58 (68%), Gaps = 4/58 (6%) Frame = -3 Query: 165 VVNLLKLSADAKWLHHGKSIHAQLVIHNH----SDITLLNSLIHFYVKCDQLHLSRIL 4 + NLLKLSA AK L GK+IHAQLV+ N SDIT +NSLI+ Y +C QL +R L Sbjct: 26 LANLLKLSATAKSLRFGKTIHAQLVVRNQTSKDSDITQMNSLINLYSECGQLKCARKL 83 >gb|KRG93547.1| hypothetical protein GLYMA_19G023400, partial [Glycine max] Length = 471 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/58 (56%), Positives = 40/58 (68%), Gaps = 4/58 (6%) Frame = -3 Query: 165 VVNLLKLSADAKWLHHGKSIHAQLVIHNH----SDITLLNSLIHFYVKCDQLHLSRIL 4 + NLLKLSA AK L GK+IHAQLV+ N SDIT +NSLI+ Y +C QL +R L Sbjct: 26 LANLLKLSATAKSLRFGKTIHAQLVVRNQTSKDSDITQMNSLINLYSECGQLKCARKL 83 >ref|XP_007151236.1| hypothetical protein PHAVU_004G029400g [Phaseolus vulgaris] gb|ESW23230.1| hypothetical protein PHAVU_004G029400g [Phaseolus vulgaris] Length = 690 Score = 58.9 bits (141), Expect = 5e-07 Identities = 34/63 (53%), Positives = 42/63 (66%), Gaps = 4/63 (6%) Frame = -3 Query: 177 KVASVVNLLKLSADAKWLHHGKSIHAQLVIHNH----SDITLLNSLIHFYVKCDQLHLSR 10 K +VNLLKLSA +K L GK+IHAQL++ N S IT +NSLI+ Y KC QL +R Sbjct: 9 KFKELVNLLKLSATSKSLRLGKTIHAQLLVCNQTSKDSGITQINSLINLYSKCGQLEYAR 68 Query: 9 ILF 1 LF Sbjct: 69 KLF 71 >ref|XP_011655117.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Cucumis sativus] ref|XP_011655118.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Cucumis sativus] ref|XP_011655119.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Cucumis sativus] gb|KGN50862.1| hypothetical protein Csa_5G292190 [Cucumis sativus] Length = 708 Score = 58.5 bits (140), Expect = 7e-07 Identities = 30/58 (51%), Positives = 41/58 (70%), Gaps = 4/58 (6%) Frame = -3 Query: 162 VNLLKLSADAKWLHHGKSIHAQLVIHNH----SDITLLNSLIHFYVKCDQLHLSRILF 1 + LLK++ADAK L G++IHA L I NH S + LNSLI+ YVKCD++ ++R LF Sbjct: 34 IKLLKVAADAKNLKFGRTIHAHLTITNHNYRDSKVNQLNSLINLYVKCDEVSIARKLF 91 >ref|XP_015879393.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Ziziphus jujuba] Length = 709 Score = 58.2 bits (139), Expect = 9e-07 Identities = 31/58 (53%), Positives = 40/58 (68%), Gaps = 4/58 (6%) Frame = -3 Query: 162 VNLLKLSADAKWLHHGKSIHAQLVIHNHS----DITLLNSLIHFYVKCDQLHLSRILF 1 + +LK++AD K L GK IHAQL+I N + DIT NSLI YVKCDQ+ ++R LF Sbjct: 34 IRILKVAADTKDLKLGKIIHAQLIISNQTSTDTDITRTNSLISLYVKCDQVSIARQLF 91 >emb|CBI36340.3| unnamed protein product, partial [Vitis vinifera] Length = 630 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/57 (52%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = -3 Query: 162 VNLLKLSADAKWLHHGKSIHAQLVIHNHS---DITLLNSLIHFYVKCDQLHLSRILF 1 + LLK+SAD K L GK IHA L+I N + +I +NSLI+ Y KCDQ+ ++RILF Sbjct: 260 IQLLKVSADTKNLKFGKMIHAHLIITNQATKDNIVQVNSLINLYAKCDQIMVARILF 316 >ref|XP_002265258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Vitis vinifera] ref|XP_010654799.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Vitis vinifera] ref|XP_010654801.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Vitis vinifera] ref|XP_019077537.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Vitis vinifera] ref|XP_019077538.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Vitis vinifera] ref|XP_019077539.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680 [Vitis vinifera] Length = 703 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/57 (52%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = -3 Query: 162 VNLLKLSADAKWLHHGKSIHAQLVIHNHS---DITLLNSLIHFYVKCDQLHLSRILF 1 + LLK+SAD K L GK IHA L+I N + +I +NSLI+ Y KCDQ+ ++RILF Sbjct: 29 IQLLKVSADTKNLKFGKMIHAHLIITNQATKDNIVQVNSLINLYAKCDQIMVARILF 85 >ref|XP_022144415.1| pentatricopeptide repeat-containing protein At5g39680 [Momordica charantia] Length = 704 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/58 (50%), Positives = 41/58 (70%), Gaps = 4/58 (6%) Frame = -3 Query: 162 VNLLKLSADAKWLHHGKSIHAQLVIHNHSD----ITLLNSLIHFYVKCDQLHLSRILF 1 + LLKL+ADAK L G+ IHA L+I NH+ + +NSLI+FY KCD+L ++R +F Sbjct: 29 IKLLKLAADAKNLKFGRIIHAHLIITNHTPGDCRVNQINSLINFYAKCDELLVARQMF 86