BLASTX nr result
ID: Astragalus24_contig00029291
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029291 (337 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610950.1| pentatricopeptide (PPR) repeat protein [Medi... 64 2e-09 dbj|GAU12441.1| hypothetical protein TSUD_229750 [Trifolium subt... 64 2e-09 gb|PNX96497.1| pentatricopeptide repeat-containing protein at4g2... 64 2e-09 gb|OIV94950.1| hypothetical protein TanjilG_22147 [Lupinus angus... 62 1e-08 ref|XP_019422023.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-08 ref|XP_004511497.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-08 ref|XP_019422022.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-08 gb|KRH77686.1| hypothetical protein GLYMA_01G228000 [Glycine max] 61 2e-08 gb|KHN25619.1| Pentatricopeptide repeat-containing protein [Glyc... 61 2e-08 ref|XP_014632699.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-08 gb|KYP52651.1| Pentatricopeptide repeat-containing protein At4g2... 59 8e-08 ref|XP_020230152.1| pentatricopeptide repeat-containing protein ... 59 8e-08 ref|XP_007156996.1| hypothetical protein PHAVU_002G034900g [Phas... 59 1e-07 ref|XP_014515621.1| pentatricopeptide repeat-containing protein ... 55 1e-06 ref|XP_022634744.1| pentatricopeptide repeat-containing protein ... 55 2e-06 ref|XP_014516075.1| pentatricopeptide repeat-containing protein ... 55 2e-06 ref|XP_017439850.1| PREDICTED: pentatricopeptide repeat-containi... 55 3e-06 ref|XP_009353870.1| PREDICTED: pentatricopeptide repeat-containi... 54 4e-06 ref|XP_008383448.1| PREDICTED: pentatricopeptide repeat-containi... 54 4e-06 >ref|XP_003610950.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AES93908.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 831 Score = 63.9 bits (154), Expect = 2e-09 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 LE KQVH + QKLG Y + VAS +INV SK GK+ +SKH F + EL +VCWN + A Sbjct: 434 LEAGKQVHAVSQKLGFYDDVYVASSLINVYSKCGKMEVSKHVFSKLSELDVVCWNSMIA 492 >dbj|GAU12441.1| hypothetical protein TSUD_229750 [Trifolium subterraneum] Length = 503 Score = 63.5 bits (153), Expect = 2e-09 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 LE KQVH + QKLG Y + VAS +INV SK GK+ LS+H F + EL +VCWN + A Sbjct: 199 LEAGKQVHAVSQKLGFYDDVYVASSLINVYSKCGKMELSEHVFSKLSELDVVCWNSMIA 257 >gb|PNX96497.1| pentatricopeptide repeat-containing protein at4g20770-like protein [Trifolium pratense] gb|PNX98570.1| pentatricopeptide repeat-containing protein at4g20770-like protein [Trifolium pratense] gb|PNY10468.1| pentatricopeptide repeat-containing protein at4g20770-like protein [Trifolium pratense] Length = 676 Score = 63.5 bits (153), Expect = 2e-09 Identities = 32/59 (54%), Positives = 40/59 (67%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 LE KQVH + QKLG Y + VAS +INV SK GK+ LS+H F + EL +VCWN + A Sbjct: 338 LEAGKQVHAVSQKLGFYDDVYVASSLINVYSKCGKMELSEHVFSKLSELDVVCWNSMIA 396 >gb|OIV94950.1| hypothetical protein TanjilG_22147 [Lupinus angustifolius] Length = 667 Score = 61.6 bits (148), Expect = 1e-08 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = +1 Query: 148 ENIRLEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNP 327 E + LE KQVH K G++ + VAS +INV SK GK+ LSKH F+ + EL +VCWN Sbjct: 322 ELVLLEAGKQVHAASMKFGLHNDVYVASGLINVYSKCGKIELSKHVFNKVPELDVVCWNS 381 Query: 328 LTA 336 + A Sbjct: 382 MIA 384 >ref|XP_019422023.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 isoform X2 [Lupinus angustifolius] Length = 701 Score = 61.6 bits (148), Expect = 1e-08 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = +1 Query: 148 ENIRLEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNP 327 E + LE KQVH K G++ + VAS +INV SK GK+ LSKH F+ + EL +VCWN Sbjct: 433 ELVLLEAGKQVHAASMKFGLHNDVYVASGLINVYSKCGKIELSKHVFNKVPELDVVCWNS 492 Query: 328 LTA 336 + A Sbjct: 493 MIA 495 >ref|XP_004511497.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 [Cicer arietinum] Length = 769 Score = 61.6 bits (148), Expect = 1e-08 Identities = 31/59 (52%), Positives = 40/59 (67%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 LE KQVH + QKLG + + VAS +INV SK GK+ LSK+ F + EL +VCWN + A Sbjct: 438 LESGKQVHAVSQKLGFFDDLYVASSLINVYSKCGKMELSKNVFSKLSELDVVCWNSMIA 496 >ref|XP_019422022.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 isoform X1 [Lupinus angustifolius] Length = 778 Score = 61.6 bits (148), Expect = 1e-08 Identities = 31/63 (49%), Positives = 41/63 (65%) Frame = +1 Query: 148 ENIRLEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNP 327 E + LE KQVH K G++ + VAS +INV SK GK+ LSKH F+ + EL +VCWN Sbjct: 433 ELVLLEAGKQVHAASMKFGLHNDVYVASGLINVYSKCGKIELSKHVFNKVPELDVVCWNS 492 Query: 328 LTA 336 + A Sbjct: 493 MIA 495 >gb|KRH77686.1| hypothetical protein GLYMA_01G228000 [Glycine max] Length = 561 Score = 61.2 bits (147), Expect = 2e-08 Identities = 31/59 (52%), Positives = 38/59 (64%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 LE K+VH QK G Y + VAS +INV SK GK+ LSKH F + EL +VCWN + A Sbjct: 223 LEAGKEVHAASQKFGFYDDVYVASSLINVYSKCGKMELSKHVFSKLPELDVVCWNSMLA 281 >gb|KHN25619.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 673 Score = 61.2 bits (147), Expect = 2e-08 Identities = 31/59 (52%), Positives = 38/59 (64%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 LE K+VH QK G Y + VAS +INV SK GK+ LSKH F + EL +VCWN + A Sbjct: 335 LEAGKEVHAASQKFGFYDDVYVASSLINVYSKCGKMELSKHVFSKLPELDVVCWNSMLA 393 >ref|XP_014632699.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 [Glycine max] Length = 770 Score = 61.2 bits (147), Expect = 2e-08 Identities = 31/59 (52%), Positives = 38/59 (64%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 LE K+VH QK G Y + VAS +INV SK GK+ LSKH F + EL +VCWN + A Sbjct: 432 LEAGKEVHAASQKFGFYDDVYVASSLINVYSKCGKMELSKHVFSKLPELDVVCWNSMLA 490 >gb|KYP52651.1| Pentatricopeptide repeat-containing protein At4g20770 family [Cajanus cajan] Length = 738 Score = 59.3 bits (142), Expect = 8e-08 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = +1 Query: 172 KQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 K+VH QK G Y + VAS +INV SK GK+ LSKH F + EL +VCWN + A Sbjct: 400 KEVHAASQKFGFYDDVYVASSLINVYSKCGKMELSKHVFSKLPELDVVCWNSMLA 454 >ref|XP_020230152.1| pentatricopeptide repeat-containing protein At4g20770 [Cajanus cajan] Length = 773 Score = 59.3 bits (142), Expect = 8e-08 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = +1 Query: 172 KQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 K+VH QK G Y + VAS +INV SK GK+ LSKH F + EL +VCWN + A Sbjct: 435 KEVHAASQKFGFYDDVYVASSLINVYSKCGKMELSKHVFSKLPELDVVCWNSMLA 489 >ref|XP_007156996.1| hypothetical protein PHAVU_002G034900g [Phaseolus vulgaris] gb|ESW28990.1| hypothetical protein PHAVU_002G034900g [Phaseolus vulgaris] Length = 774 Score = 58.5 bits (140), Expect = 1e-07 Identities = 30/59 (50%), Positives = 37/59 (62%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 LE K+VH QK G Y + VAS +INV SK GK+ L KH F + E+ IVCWN + A Sbjct: 432 LEAGKEVHAASQKFGFYDDVYVASSLINVYSKCGKMELCKHVFSKLPEVDIVCWNSMLA 490 >ref|XP_014515621.1| pentatricopeptide repeat-containing protein At4g20770-like [Vigna radiata var. radiata] Length = 286 Score = 55.5 bits (132), Expect = 1e-06 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPL 330 LE K+VH QK G Y + VAS +IN+ SK GK+ L +H F + EL IVCWN + Sbjct: 180 LEVGKEVHAAAQKFGFYDDVYVASSLINMYSKCGKMELCEHVFSKLPELDIVCWNSM 236 >ref|XP_022634744.1| pentatricopeptide repeat-containing protein At4g20770 isoform X2 [Vigna radiata var. radiata] Length = 591 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPL 330 LE K+VH QK G Y + VAS +IN+ SK GK+ L +H F + EL IVCWN + Sbjct: 249 LEVGKEVHAAAQKFGFYDDVYVASSLINMYSKCGKMELCEHVFSKLPELDIVCWNSM 305 >ref|XP_014516075.1| pentatricopeptide repeat-containing protein At4g20770 isoform X1 [Vigna radiata var. radiata] ref|XP_014516150.1| pentatricopeptide repeat-containing protein At4g20770 isoform X1 [Vigna radiata var. radiata] ref|XP_014516223.1| pentatricopeptide repeat-containing protein At4g20770 isoform X1 [Vigna radiata var. radiata] ref|XP_014516298.1| pentatricopeptide repeat-containing protein At4g20770 isoform X1 [Vigna radiata var. radiata] ref|XP_022634623.1| pentatricopeptide repeat-containing protein At4g20770 isoform X1 [Vigna radiata var. radiata] ref|XP_022634650.1| pentatricopeptide repeat-containing protein At4g20770 isoform X1 [Vigna radiata var. radiata] ref|XP_022634724.1| pentatricopeptide repeat-containing protein At4g20770 isoform X1 [Vigna radiata var. radiata] Length = 774 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPL 330 LE K+VH QK G Y + VAS +IN+ SK GK+ L +H F + EL IVCWN + Sbjct: 432 LEVGKEVHAAAQKFGFYDDVYVASSLINMYSKCGKMELCEHVFSKLPELDIVCWNSM 488 >ref|XP_017439850.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 [Vigna angularis] ref|XP_017439851.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 [Vigna angularis] ref|XP_017439853.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 [Vigna angularis] gb|KOM55290.1| hypothetical protein LR48_Vigan10g118200 [Vigna angularis] dbj|BAU02168.1| hypothetical protein VIGAN_11161800 [Vigna angularis var. angularis] Length = 774 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPL 330 LE K+VH QK G Y + VAS +IN+ SK GK+ L +H F + EL IVCWN + Sbjct: 432 LEVGKEVHAAAQKFGFYDDVYVASSLINMYSKCGKMELCEHVFRKLPELDIVCWNSM 488 >ref|XP_009353870.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 [Pyrus x bretschneideri] Length = 776 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 LE K+VH QK + + VAS +I + SK GK ++KH F ++LEL IVCWN + A Sbjct: 436 LEAGKEVHAASQKAAFHTDIYVASGLIGMYSKCGKTEMAKHIFHSMLELDIVCWNSMLA 494 >ref|XP_008383448.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770 [Malus domestica] ref|XP_008349144.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20770-like [Malus domestica] Length = 776 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = +1 Query: 160 LEQMKQVHLLFQKLGIYVSMDVASRIINVSSKYGKVTLSKHWFDNILELYIVCWNPLTA 336 LE K+VH QK + + VAS +I + SK GK ++KH F ++LEL IVCWN + A Sbjct: 436 LEAGKEVHAASQKAAFHTDIYVASGLIGMYSKCGKTEMAKHIFHSMLELDIVCWNSMLA 494