BLASTX nr result
ID: Astragalus24_contig00029253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00029253 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM37544.1| hypothetical protein LR48_Vigan03g092600 [Vigna a... 59 9e-08 ref|XP_007140360.1| hypothetical protein PHAVU_008G105400g [Phas... 59 1e-07 ref|XP_012569025.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymera... 58 2e-07 ref|XP_014514152.1| RNA polymerase II C-terminal domain phosphat... 54 9e-06 ref|XP_014514150.1| RNA polymerase II C-terminal domain phosphat... 54 9e-06 >gb|KOM37544.1| hypothetical protein LR48_Vigan03g092600 [Vigna angularis] Length = 838 Score = 59.3 bits (142), Expect = 9e-08 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 4/46 (8%) Frame = -3 Query: 351 FDKLSLGQENGFL----DPESSELQTEDGLPRESASEVGIFEDFGS 226 FDKLSLG++NGFL +PES+E QTEDG+PRE+ASEVG F S Sbjct: 793 FDKLSLGRDNGFLWDVVNPESNEPQTEDGMPRENASEVGFLNVFSS 838 >ref|XP_007140360.1| hypothetical protein PHAVU_008G105400g [Phaseolus vulgaris] gb|ESW12354.1| hypothetical protein PHAVU_008G105400g [Phaseolus vulgaris] Length = 806 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 4/46 (8%) Frame = -3 Query: 351 FDKLSLGQENGFL----DPESSELQTEDGLPRESASEVGIFEDFGS 226 FDKLSLG++NGFL +PES+EL+ EDG+PRE+ASEVG FGS Sbjct: 761 FDKLSLGRDNGFLWDVVNPESNELRREDGVPRENASEVGFRNVFGS 806 >ref|XP_012569025.1| PREDICTED: LOW QUALITY PROTEIN: RNA polymerase II C-terminal domain phosphatase-like 2 [Cicer arietinum] Length = 802 Score = 58.2 bits (139), Expect = 2e-07 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 4/37 (10%) Frame = -3 Query: 351 FDKLSLGQENGFL----DPESSELQTEDGLPRESASE 253 FDKLSLG ENGFL +PE+SELQTEDGLPRESASE Sbjct: 734 FDKLSLGHENGFLWDVVNPETSELQTEDGLPRESASE 770 >ref|XP_014514152.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform X2 [Vigna radiata var. radiata] Length = 827 Score = 53.5 bits (127), Expect = 9e-06 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 4/37 (10%) Frame = -3 Query: 351 FDKLSLGQENGFL----DPESSELQTEDGLPRESASE 253 FDKLSLG++NGFL +PES+ELQTEDG+PRE+ SE Sbjct: 753 FDKLSLGRDNGFLWDVVNPESNELQTEDGVPRENVSE 789 >ref|XP_014514150.1| RNA polymerase II C-terminal domain phosphatase-like 2 isoform X1 [Vigna radiata var. radiata] Length = 835 Score = 53.5 bits (127), Expect = 9e-06 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 4/37 (10%) Frame = -3 Query: 351 FDKLSLGQENGFL----DPESSELQTEDGLPRESASE 253 FDKLSLG++NGFL +PES+ELQTEDG+PRE+ SE Sbjct: 761 FDKLSLGRDNGFLWDVVNPESNELQTEDGVPRENVSE 797