BLASTX nr result
ID: Astragalus24_contig00028995
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00028995 (371 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004493520.1| PREDICTED: putative pentatricopeptide repeat... 194 2e-56 gb|PNX93835.1| pentatricopeptide repeat-containing protein at5g5... 186 2e-56 gb|KYP70542.1| Putative pentatricopeptide repeat-containing prot... 188 7e-56 dbj|GAU50548.1| hypothetical protein TSUD_409920 [Trifolium subt... 189 1e-55 gb|KHN26334.1| Putative pentatricopeptide repeat-containing prot... 187 9e-55 ref|XP_020211049.1| putative pentatricopeptide repeat-containing... 188 1e-54 ref|XP_003625160.1| RNAediting factor 1 [Medicago truncatula] >g... 187 5e-54 ref|XP_003553418.1| PREDICTED: putative pentatricopeptide repeat... 187 5e-54 ref|XP_007162241.1| hypothetical protein PHAVU_001G135800g [Phas... 185 2e-53 ref|XP_017418379.1| PREDICTED: putative pentatricopeptide repeat... 181 1e-51 ref|XP_014495786.1| putative pentatricopeptide repeat-containing... 180 2e-51 gb|OIW05204.1| hypothetical protein TanjilG_19835 [Lupinus angus... 176 4e-51 ref|XP_020990709.1| putative pentatricopeptide repeat-containing... 179 4e-51 ref|XP_016183128.1| putative pentatricopeptide repeat-containing... 179 4e-51 ref|XP_012468047.1| PREDICTED: putative pentatricopeptide repeat... 170 2e-50 ref|XP_016492225.1| PREDICTED: putative pentatricopeptide repeat... 167 8e-50 ref|XP_019456091.1| PREDICTED: putative pentatricopeptide repeat... 176 1e-49 ref|XP_020971216.1| putative pentatricopeptide repeat-containing... 175 2e-49 ref|XP_008358389.2| PREDICTED: LOW QUALITY PROTEIN: putative pen... 174 3e-49 ref|XP_004234835.1| PREDICTED: putative pentatricopeptide repeat... 174 3e-49 >ref|XP_004493520.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Cicer arietinum] Length = 594 Score = 194 bits (492), Expect = 2e-56 Identities = 100/123 (81%), Positives = 103/123 (83%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+VIEEMPMEPTESVWGALLTGCRIHG TELASYVADRVSE G VSSGL VLLSN Sbjct: 379 VKVIEEMPMEPTESVWGALLTGCRIHGNTELASYVADRVSEMGSVSSGLHVLLSNAYAAA 438 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKM+RD GIKKETGLSWVEEGNRVHTFAAGDRSH KTVEIY+KLEELGEEM Sbjct: 439 GRWEEAAKARKMLRDTGIKKETGLSWVEEGNRVHTFAAGDRSHAKTVEIYDKLEELGEEM 498 Query: 11 AKA 3 AKA Sbjct: 499 AKA 501 >gb|PNX93835.1| pentatricopeptide repeat-containing protein at5g52630-like protein [Trifolium pratense] Length = 305 Score = 186 bits (472), Expect = 2e-56 Identities = 97/123 (78%), Positives = 102/123 (82%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+VIEEMPMEPTESV GALLTGCRIHG TELASYVADRVSE G VSSGLQVLLSN Sbjct: 90 VKVIEEMPMEPTESVLGALLTGCRIHGNTELASYVADRVSELGSVSSGLQVLLSNAYAAA 149 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RK +RD+GIKKETGLSWVEEGNRVHTFAAGDRSH KT+EIY+KLEELGEEM Sbjct: 150 GRWEEAARARKTLRDKGIKKETGLSWVEEGNRVHTFAAGDRSHAKTLEIYDKLEELGEEM 209 Query: 11 AKA 3 KA Sbjct: 210 EKA 212 >gb|KYP70542.1| Putative pentatricopeptide repeat-containing protein At5g52630 family [Cajanus cajan] Length = 427 Score = 188 bits (478), Expect = 7e-56 Identities = 95/123 (77%), Positives = 102/123 (82%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+V+EEMP+EPTESVWGALLTGCRIHG ELAS+VAD+VSE G VSSG+QVLLSN Sbjct: 212 VKVVEEMPVEPTESVWGALLTGCRIHGNAELASFVADKVSEMGAVSSGIQVLLSNAYAAA 271 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RK MRD GIKKETGLSWVEEGNRVHTFAAGDRSHGKT+EIY KLEELGEEM Sbjct: 272 GRWEEAARARKRMRDEGIKKETGLSWVEEGNRVHTFAAGDRSHGKTLEIYEKLEELGEEM 331 Query: 11 AKA 3 AKA Sbjct: 332 AKA 334 >dbj|GAU50548.1| hypothetical protein TSUD_409920 [Trifolium subterraneum] Length = 485 Score = 189 bits (480), Expect = 1e-55 Identities = 96/122 (78%), Positives = 103/122 (84%) Frame = -1 Query: 368 RVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXXX 189 +VIEEMPMEPTESVWGALLTGCRIHG TELASYVADRVSE+G VSSGLQVLLSN Sbjct: 271 KVIEEMPMEPTESVWGALLTGCRIHGNTELASYVADRVSETGAVSSGLQVLLSNAYAAAG 330 Query: 188 XXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEMA 9 RK +RD+GIKKETGLSWVEEGNRVHTFAAGDRSH K++EIY+KLEELGEEM Sbjct: 331 RWEEAAKARKTLRDKGIKKETGLSWVEEGNRVHTFAAGDRSHAKSLEIYDKLEELGEEME 390 Query: 8 KA 3 KA Sbjct: 391 KA 392 >gb|KHN26334.1| Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 484 Score = 187 bits (474), Expect = 9e-55 Identities = 96/123 (78%), Positives = 102/123 (82%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V VI+EMPM+PTESVWGALLTGCRIHG TELAS+VAD+V E G VSSG+QVLLSN Sbjct: 269 VLVIKEMPMQPTESVWGALLTGCRIHGNTELASFVADKVFEMGAVSSGIQVLLSNAYAAA 328 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKMMRD+GIKKETGLSWVEEGNRVHTFAAGDRSHGKT EIY KLEELGEEM Sbjct: 329 GRWEEAARARKMMRDQGIKKETGLSWVEEGNRVHTFAAGDRSHGKTREIYEKLEELGEEM 388 Query: 11 AKA 3 AKA Sbjct: 389 AKA 391 >ref|XP_020211049.1| putative pentatricopeptide repeat-containing protein At5g52630 [Cajanus cajan] Length = 582 Score = 188 bits (478), Expect = 1e-54 Identities = 95/123 (77%), Positives = 102/123 (82%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+V+EEMP+EPTESVWGALLTGCRIHG ELAS+VAD+VSE G VSSG+QVLLSN Sbjct: 367 VKVVEEMPVEPTESVWGALLTGCRIHGNAELASFVADKVSEMGAVSSGIQVLLSNAYAAA 426 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RK MRD GIKKETGLSWVEEGNRVHTFAAGDRSHGKT+EIY KLEELGEEM Sbjct: 427 GRWEEAARARKRMRDEGIKKETGLSWVEEGNRVHTFAAGDRSHGKTLEIYEKLEELGEEM 486 Query: 11 AKA 3 AKA Sbjct: 487 AKA 489 >ref|XP_003625160.1| RNAediting factor 1 [Medicago truncatula] gb|ABN08217.1| Tetratricopeptide-like helical [Medicago truncatula] gb|AES81378.1| RNAediting factor 1 [Medicago truncatula] Length = 596 Score = 187 bits (475), Expect = 5e-54 Identities = 94/123 (76%), Positives = 103/123 (83%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V++IEEMPMEPTESVWGALLTGCR+HG T+LASYVADRVSE G VSSGL V+LSN Sbjct: 381 VKLIEEMPMEPTESVWGALLTGCRLHGNTKLASYVADRVSELGSVSSGLHVMLSNAYAAA 440 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKMMRDRGIKKETGLSWVEEGNR+HTFAAGDRSH K+VEIY+KL+ELGEEM Sbjct: 441 GRWEEAAKARKMMRDRGIKKETGLSWVEEGNRIHTFAAGDRSHAKSVEIYDKLDELGEEM 500 Query: 11 AKA 3 KA Sbjct: 501 DKA 503 >ref|XP_003553418.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Glycine max] gb|KRG95289.1| hypothetical protein GLYMA_19G141800 [Glycine max] Length = 582 Score = 187 bits (474), Expect = 5e-54 Identities = 96/123 (78%), Positives = 102/123 (82%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V VI+EMPM+PTESVWGALLTGCRIHG TELAS+VAD+V E G VSSG+QVLLSN Sbjct: 367 VLVIKEMPMQPTESVWGALLTGCRIHGNTELASFVADKVFEMGAVSSGIQVLLSNAYAAA 426 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKMMRD+GIKKETGLSWVEEGNRVHTFAAGDRSHGKT EIY KLEELGEEM Sbjct: 427 GRWEEAARARKMMRDQGIKKETGLSWVEEGNRVHTFAAGDRSHGKTREIYEKLEELGEEM 486 Query: 11 AKA 3 AKA Sbjct: 487 AKA 489 >ref|XP_007162241.1| hypothetical protein PHAVU_001G135800g [Phaseolus vulgaris] gb|ESW34235.1| hypothetical protein PHAVU_001G135800g [Phaseolus vulgaris] Length = 583 Score = 185 bits (470), Expect = 2e-53 Identities = 93/123 (75%), Positives = 102/123 (82%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 VRVIEEMPMEPTESVWGALLTGCRIHG T+LAS+VADRV E G VSSG+ VLLSN Sbjct: 368 VRVIEEMPMEPTESVWGALLTGCRIHGNTDLASFVADRVFEMGAVSSGINVLLSNAYAAA 427 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKM+RD+GIKKETGLSWVEEGNR+HTFAAGDRSHGKT EIY KLE+LGE++ Sbjct: 428 GRWEEAARARKMLRDQGIKKETGLSWVEEGNRIHTFAAGDRSHGKTKEIYEKLEDLGEKL 487 Query: 11 AKA 3 AKA Sbjct: 488 AKA 490 >ref|XP_017418379.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Vigna angularis] dbj|BAT85282.1| hypothetical protein VIGAN_04281100 [Vigna angularis var. angularis] Length = 583 Score = 181 bits (458), Expect = 1e-51 Identities = 92/122 (75%), Positives = 99/122 (81%) Frame = -1 Query: 368 RVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXXX 189 RVIE MPMEPTESVWGALLTGCRIHG TE AS+VADR+ E G VSSG+ VLLSN Sbjct: 369 RVIEGMPMEPTESVWGALLTGCRIHGNTEWASFVADRIFEMGAVSSGINVLLSNAYAAAG 428 Query: 188 XXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEMA 9 RKM+RD+GIKKETGLSWVEEGNRVHTFAAGDRSHGKT EIY KLEELGE++A Sbjct: 429 RWEEAARARKMLRDQGIKKETGLSWVEEGNRVHTFAAGDRSHGKTKEIYEKLEELGEKIA 488 Query: 8 KA 3 KA Sbjct: 489 KA 490 >ref|XP_014495786.1| putative pentatricopeptide repeat-containing protein At5g52630 [Vigna radiata var. radiata] Length = 583 Score = 180 bits (456), Expect = 2e-51 Identities = 91/122 (74%), Positives = 99/122 (81%) Frame = -1 Query: 368 RVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXXX 189 RVIE MPMEPTESVWGALLTGCR+HG TE AS+VADR+ E G VSSG+ VLLSN Sbjct: 369 RVIEGMPMEPTESVWGALLTGCRLHGNTEWASFVADRIFEMGAVSSGINVLLSNAYAAAG 428 Query: 188 XXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEMA 9 RKM+RD+GIKKETGLSWVEEGNRVHTFAAGDRSHGKT EIY KLEELGE++A Sbjct: 429 RWEEAARARKMLRDQGIKKETGLSWVEEGNRVHTFAAGDRSHGKTKEIYEKLEELGEKIA 488 Query: 8 KA 3 KA Sbjct: 489 KA 490 >gb|OIW05204.1| hypothetical protein TanjilG_19835 [Lupinus angustifolius] Length = 409 Score = 176 bits (445), Expect = 4e-51 Identities = 89/123 (72%), Positives = 97/123 (78%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+V+ EMPM PTESVWGALLTGCRIHG TELASYVADRV E G VS G+ +LLSN Sbjct: 268 VQVVREMPMGPTESVWGALLTGCRIHGNTELASYVADRVFELGPVSPGVHILLSNAYAAA 327 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RK +RD+GIKKETGLSWVEEGNR+HTFAAGDRSH KT EIY+KLEELGEEM Sbjct: 328 GRWEEAARARKTLRDQGIKKETGLSWVEEGNRMHTFAAGDRSHAKTAEIYDKLEELGEEM 387 Query: 11 AKA 3 KA Sbjct: 388 EKA 390 >ref|XP_020990709.1| putative pentatricopeptide repeat-containing protein At5g52630 isoform X1 [Arachis duranensis] ref|XP_020990710.1| putative pentatricopeptide repeat-containing protein At5g52630 isoform X1 [Arachis duranensis] ref|XP_020990711.1| putative pentatricopeptide repeat-containing protein At5g52630 isoform X1 [Arachis duranensis] Length = 593 Score = 179 bits (455), Expect = 4e-51 Identities = 90/123 (73%), Positives = 99/123 (80%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+V++EMPM PTESVWGALLTGCRIHG TELASYVADR+ E G +SSG+ VLLSN Sbjct: 378 VQVVQEMPMHPTESVWGALLTGCRIHGNTELASYVADRLFELGSLSSGVHVLLSNAYAAA 437 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKM+RD+GIKKETGLSWVEEGN+VHTFAAGDRSH KT EIY KLEELGEEM Sbjct: 438 GRWEEAARARKMLRDQGIKKETGLSWVEEGNKVHTFAAGDRSHAKTTEIYKKLEELGEEM 497 Query: 11 AKA 3 KA Sbjct: 498 EKA 500 >ref|XP_016183128.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971217.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971218.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971219.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971220.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971221.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971223.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971224.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971225.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971226.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971227.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971228.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] ref|XP_020971229.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] Length = 593 Score = 179 bits (455), Expect = 4e-51 Identities = 90/123 (73%), Positives = 99/123 (80%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+V++EMPM PTESVWGALLTGCRIHG TELASYVADR+ E G +SSG+ VLLSN Sbjct: 378 VQVVQEMPMHPTESVWGALLTGCRIHGNTELASYVADRLFELGSLSSGVHVLLSNAYAAA 437 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKM+RD+GIKKETGLSWVEEGN+VHTFAAGDRSH KT EIY KLEELGEEM Sbjct: 438 GRWEEAARARKMLRDQGIKKETGLSWVEEGNKVHTFAAGDRSHAKTTEIYKKLEELGEEM 497 Query: 11 AKA 3 KA Sbjct: 498 EKA 500 >ref|XP_012468047.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Gossypium raimondii] Length = 273 Score = 170 bits (430), Expect = 2e-50 Identities = 84/121 (69%), Positives = 93/121 (76%) Frame = -1 Query: 365 VIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXXXX 186 +I EMP+ PTESVWGA LTGCR+HG TELA+Y ADR+ E G VSSGL VLLSN Sbjct: 126 IIREMPIRPTESVWGAFLTGCRLHGNTELAAYAADRIFELGPVSSGLHVLLSNAYAAAGR 185 Query: 185 XXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEMAK 6 RKM+RDRGIKKETGLSWVEEGN+VHTFAAGDRSH K EIY KLEELG+EM + Sbjct: 186 YEDAAKARKMLRDRGIKKETGLSWVEEGNKVHTFAAGDRSHAKAKEIYRKLEELGDEMGR 245 Query: 5 A 3 A Sbjct: 246 A 246 >ref|XP_016492225.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Nicotiana tabacum] Length = 245 Score = 167 bits (424), Expect = 8e-50 Identities = 84/123 (68%), Positives = 97/123 (78%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+V+EEMPM+PTESVWGALLTGCRIH TELA+YVAD V E G VSSG+ VLLSN Sbjct: 30 VQVVEEMPMQPTESVWGALLTGCRIHKNTELAAYVADSVFELGPVSSGVHVLLSNAYAAA 89 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKM+RDRG+KKETGLSWVEEGN+VHTFAAGDRSH K+ EIY KL+ELG+ + Sbjct: 90 GRYQEAAKARKMLRDRGVKKETGLSWVEEGNKVHTFAAGDRSHSKSKEIYKKLDELGDYI 149 Query: 11 AKA 3 +A Sbjct: 150 EQA 152 >ref|XP_019456091.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Lupinus angustifolius] Length = 601 Score = 176 bits (445), Expect = 1e-49 Identities = 89/123 (72%), Positives = 97/123 (78%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+V+ EMPM PTESVWGALLTGCRIHG TELASYVADRV E G VS G+ +LLSN Sbjct: 386 VQVVREMPMGPTESVWGALLTGCRIHGNTELASYVADRVFELGPVSPGVHILLSNAYAAA 445 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RK +RD+GIKKETGLSWVEEGNR+HTFAAGDRSH KT EIY+KLEELGEEM Sbjct: 446 GRWEEAARARKTLRDQGIKKETGLSWVEEGNRMHTFAAGDRSHAKTAEIYDKLEELGEEM 505 Query: 11 AKA 3 KA Sbjct: 506 EKA 508 >ref|XP_020971216.1| putative pentatricopeptide repeat-containing protein At5g52630 [Arachis ipaensis] Length = 593 Score = 175 bits (443), Expect = 2e-49 Identities = 88/123 (71%), Positives = 97/123 (78%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+V++EMPM+PTESVWGALLTGCRIHG TELASYVADRV E G +S+G+ VLL N Sbjct: 378 VQVVQEMPMQPTESVWGALLTGCRIHGNTELASYVADRVFELGSLSAGVHVLLINAYAAA 437 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKM+RDRGIKKETGLSWVEEGN+VHTF A DRSH KT EIY KLEELGEEM Sbjct: 438 GRWEEAARARKMLRDRGIKKETGLSWVEEGNKVHTFVARDRSHAKTTEIYKKLEELGEEM 497 Query: 11 AKA 3 KA Sbjct: 498 EKA 500 >ref|XP_008358389.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At5g52630 [Malus domestica] Length = 596 Score = 174 bits (442), Expect = 3e-49 Identities = 87/123 (70%), Positives = 99/123 (80%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V++I+EMP+EPTES+WGALLTGCRIHG TELA+ VADRV E G VSSGL VLLSN Sbjct: 381 VKIIDEMPIEPTESIWGALLTGCRIHGDTELAASVADRVFELGPVSSGLHVLLSNAYAAA 440 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKM+RDRG+KKETGLSWVEEGN++HTFAAGDR+H +T EIY KLEELGEEM Sbjct: 441 QRFEEAAKVRKMLRDRGVKKETGLSWVEEGNKIHTFAAGDRTHMRTKEIYEKLEELGEEM 500 Query: 11 AKA 3 KA Sbjct: 501 EKA 503 >ref|XP_004234835.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g52630 [Solanum lycopersicum] Length = 596 Score = 174 bits (442), Expect = 3e-49 Identities = 89/123 (72%), Positives = 98/123 (79%) Frame = -1 Query: 371 VRVIEEMPMEPTESVWGALLTGCRIHGKTELASYVADRVSESGYVSSGLQVLLSNXXXXX 192 V+VIE+MPMEPTESVWGALLTGCRIH TELA+YVADRV E G VSSGL VLLSN Sbjct: 381 VQVIEKMPMEPTESVWGALLTGCRIHKNTELAAYVADRVLELGPVSSGLHVLLSNAYAAA 440 Query: 191 XXXXXXXXXRKMMRDRGIKKETGLSWVEEGNRVHTFAAGDRSHGKTVEIYNKLEELGEEM 12 RKM+RDRG+KKETGLSWVEEGN+VHTFAAGDRSH K+ EIY KL+ELGE M Sbjct: 441 GRYEEAAKARKMLRDRGVKKETGLSWVEEGNKVHTFAAGDRSHSKSKEIYEKLDELGEHM 500 Query: 11 AKA 3 +A Sbjct: 501 EQA 503