BLASTX nr result
ID: Astragalus24_contig00028976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00028976 (324 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMP06822.1| hypothetical protein CCACVL1_01437, partial [Corc... 89 1e-19 gb|EEF45749.1| conserved hypothetical protein [Ricinus communis] 57 3e-08 dbj|GAY68548.1| hypothetical protein CUMW_265020 [Citrus unshiu] 54 4e-06 >gb|OMP06822.1| hypothetical protein CCACVL1_01437, partial [Corchorus capsularis] Length = 201 Score = 88.6 bits (218), Expect = 1e-19 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = -1 Query: 324 PLKTVRAGLPACGSRHSRWPSPAFIRKSCSEIETARPRKLIR 199 PLKTVRAGLPACGSRHSRWPSPAFIRKSCSEIETARPRK IR Sbjct: 34 PLKTVRAGLPACGSRHSRWPSPAFIRKSCSEIETARPRKRIR 75 >gb|EEF45749.1| conserved hypothetical protein [Ricinus communis] Length = 166 Score = 56.6 bits (135), Expect(2) = 3e-08 Identities = 35/81 (43%), Positives = 36/81 (44%) Frame = -1 Query: 324 PLKTVRAGLPACGSRHSRWPSPAFIRKSCSEIETARPRKLIRV*AALSVVPLTXXXXXXX 145 PLKTV AGLP CGS HSRW SPAFI KSCS Sbjct: 50 PLKTVCAGLPTCGSCHSRWSSPAFIHKSCSS----------------------------- 80 Query: 144 XXXXXXIGLLPLFPRINELPL 82 LPLFPRI+ LPL Sbjct: 81 ---------LPLFPRIHVLPL 92 Score = 28.9 bits (63), Expect(2) = 3e-08 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -2 Query: 35 AFHFRQMTRPP 3 AFHFRQMTRPP Sbjct: 103 AFHFRQMTRPP 113 >dbj|GAY68548.1| hypothetical protein CUMW_265020 [Citrus unshiu] Length = 317 Score = 53.9 bits (128), Expect = 4e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +2 Query: 242 DLRMNAGLGHLEWREPHAGRPART 313 DLRMNAGL HLEWREPHAGRPART Sbjct: 229 DLRMNAGLDHLEWREPHAGRPART 252