BLASTX nr result
ID: Astragalus24_contig00028798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00028798 (607 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU42350.1| hypothetical protein TSUD_350160, partial [Trifo... 60 4e-07 gb|PNY05106.1| histone-lysine N-methyltransferase ATX3-like prot... 59 1e-06 >dbj|GAU42350.1| hypothetical protein TSUD_350160, partial [Trifolium subterraneum] Length = 312 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 469 MMIKPTMKFEMPKVKRFKLKEPDSEGHDGSSEIQKKRRMSEFYS 600 M+IK +K EMPK+KR KL EPDSEG +G S IQKKR ++EFYS Sbjct: 1 MVIKRAVKSEMPKLKRCKLDEPDSEGPEGCSGIQKKRMVNEFYS 44 >gb|PNY05106.1| histone-lysine N-methyltransferase ATX3-like protein [Trifolium pratense] Length = 1028 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +1 Query: 469 MMIKPTMKFEMPKVKRFKLKEPDSEGHDGSSEIQKKRRMSEFYSHG 606 M+IK +K EMPK+KR KL EPDSEG +G S IQKKR +++FYS G Sbjct: 1 MVIKRAVKSEMPKLKRCKLDEPDSEGLEGCSGIQKKRMVNKFYSIG 46