BLASTX nr result
ID: Astragalus24_contig00028752
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00028752 (914 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU48495.1| hypothetical protein TSUD_291810 [Trifolium subt... 76 7e-14 gb|PNX72755.1| hypothetical protein L195_g028650, partial [Trifo... 51 8e-12 dbj|GAU46440.1| hypothetical protein TSUD_91580 [Trifolium subte... 54 9e-06 >dbj|GAU48495.1| hypothetical protein TSUD_291810 [Trifolium subterraneum] Length = 81 Score = 75.9 bits (185), Expect = 7e-14 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 121 MNDLRAPSFIARSEMSMFPLELTYVSIKAFFLFAYDAMPA 2 MNDLRAPSFIARSEMSMFP E TYVSIKAFF+FAYDAMPA Sbjct: 1 MNDLRAPSFIARSEMSMFPPEPTYVSIKAFFIFAYDAMPA 40 >gb|PNX72755.1| hypothetical protein L195_g028650, partial [Trifolium pratense] Length = 207 Score = 51.2 bits (121), Expect(2) = 8e-12 Identities = 22/23 (95%), Positives = 22/23 (95%) Frame = -2 Query: 913 SCPAREMMFDKMDLFVKERKCNG 845 SCPAREMMFDKMD FVKERKCNG Sbjct: 162 SCPAREMMFDKMDSFVKERKCNG 184 Score = 48.1 bits (113), Expect(2) = 8e-12 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -1 Query: 770 GVMLQHPLVRASEIAKDPKEKQE 702 GVMLQHPLVRAS+IAKDPKEKQE Sbjct: 184 GVMLQHPLVRASDIAKDPKEKQE 206 >dbj|GAU46440.1| hypothetical protein TSUD_91580 [Trifolium subterraneum] Length = 95 Score = 53.9 bits (128), Expect = 9e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 913 SCPAREMMFDKMDLFVKERKCNGGK 839 SCPAREMMFDKMD FVK+RKCNGGK Sbjct: 71 SCPAREMMFDKMDSFVKKRKCNGGK 95