BLASTX nr result
ID: Astragalus24_contig00028723
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00028723 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX97245.1| hypothetical protein L195_g020471, partial [Trifo... 52 3e-06 >gb|PNX97245.1| hypothetical protein L195_g020471, partial [Trifolium pratense] Length = 750 Score = 52.4 bits (124), Expect(2) = 3e-06 Identities = 24/45 (53%), Positives = 31/45 (68%), Gaps = 2/45 (4%) Frame = -2 Query: 179 SSSLNSCTFGSWIIGYGASAHICSSLNCFSVFRQI--LYLKTPYG 51 ++S NS FGSWI+ G S HICSSLNCFS + I +++K P G Sbjct: 212 TNSFNSSAFGSWIVDSGVSDHICSSLNCFSSYNSITPIHVKLPNG 256 Score = 26.2 bits (56), Expect(2) = 3e-06 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -1 Query: 321 FTHEQYEKLLNLIQGTGVNLLPRILFKSS-NIIS 223 FT +QY +LLNL+Q + + + S NI+S Sbjct: 171 FTKDQYNQLLNLVQASNASTSNNAITSSKVNIVS 204