BLASTX nr result
ID: Astragalus24_contig00028682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00028682 (345 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003614545.1| transmembrane protein, putative [Medicago tr... 67 6e-11 ref|XP_003614548.1| wall-associated kinase family protein [Medic... 68 6e-11 >ref|XP_003614545.1| transmembrane protein, putative [Medicago truncatula] gb|AES97503.1| transmembrane protein, putative [Medicago truncatula] Length = 232 Score = 67.0 bits (162), Expect = 6e-11 Identities = 41/106 (38%), Positives = 61/106 (57%), Gaps = 10/106 (9%) Frame = +1 Query: 4 NSILIYGPKINLNSIESLP----PRLKLNNISFYSCSHNINSLPPHNSMSIYKNCRDYNI 171 NS +IYG LNS E P P +N ++FY C+H ++ H++ YKNC DY+I Sbjct: 88 NSAIIYG----LNSSELEPIKNKPNFSINTVNFYVCNHGYDN--SHDNKFKYKNCADYDI 141 Query: 172 YYFTSEKDRDYLPMIPLFPFSCLP------DQLPRVSLSEIRIELD 291 YFTS D+ PM P+FP +C P + + +SL EI+++L+ Sbjct: 142 -YFTSTPDKP--PMFPIFPLACFPVPFETFNCVDIISLLEIKVDLE 184 >ref|XP_003614548.1| wall-associated kinase family protein [Medicago truncatula] gb|AES97506.1| wall-associated kinase family protein [Medicago truncatula] Length = 632 Score = 68.2 bits (165), Expect = 6e-11 Identities = 42/105 (40%), Positives = 61/105 (58%), Gaps = 9/105 (8%) Frame = +1 Query: 4 NSILIYGP---KINLNSIESLPPRLKLNNISFYSCSHNINSLPPHNSMSIYKNCRDYNIY 174 NSI+IY P K+NL S ++ P +N I+F+ C+H+ M Y+NC DY+IY Sbjct: 85 NSIIIYSPNSHKLNLESFKNRPI-FSINTINFHRCNHH------REHMFKYRNCSDYDIY 137 Query: 175 YFTSEKDRDYLPMIPLFPFSCLPDQLPR------VSLSEIRIELD 291 FTS D PM P+FPF CLP+ +P S+ EI+++L+ Sbjct: 138 -FTSIPD---YPMFPIFPFPCLPNFVPHDCAEILFSILEIKVDLE 178