BLASTX nr result
ID: Astragalus24_contig00028557
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00028557 (531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP44921.1| OTU domain-containing protein 3 [Cajanus cajan] 73 5e-12 ref|XP_020237268.1| OTU domain-containing protein 3 isoform X1 [... 73 8e-12 ref|XP_006600943.1| PREDICTED: OTU domain-containing protein 3 i... 67 9e-10 ref|XP_006600939.1| PREDICTED: OTU domain-containing protein 3 i... 67 9e-10 ref|XP_013457429.1| OTU-like cysteine protease family protein [M... 53 2e-09 gb|PNY11745.1| OTU domain-containing protein 3-like [Trifolium p... 65 6e-09 ref|XP_013457431.1| OTU-like cysteine protease family protein [M... 63 2e-08 ref|XP_013457430.1| OTU-like cysteine protease family protein [M... 63 2e-08 ref|XP_016185369.1| OTU domain-containing protein 3 isoform X5 [... 63 2e-08 ref|XP_016185362.1| OTU domain-containing protein 3 isoform X4 [... 63 2e-08 ref|XP_016185356.1| OTU domain-containing protein 3 isoform X3 [... 63 3e-08 ref|XP_016185350.1| OTU domain-containing protein 3 isoform X2 [... 63 3e-08 ref|XP_016185346.1| OTU domain-containing protein 3 isoform X1 [... 63 3e-08 gb|KOM32346.1| hypothetical protein LR48_Vigan01g190200 [Vigna a... 61 7e-08 ref|XP_017410902.1| PREDICTED: OTU domain-containing protein 3 i... 61 1e-07 ref|XP_017410892.1| PREDICTED: OTU domain-containing protein 3 i... 61 1e-07 ref|XP_017410884.1| PREDICTED: OTU domain-containing protein 3 i... 61 1e-07 ref|XP_014509808.1| OTU domain-containing protein 3 isoform X2 [... 61 1e-07 ref|XP_017410875.1| PREDICTED: OTU domain-containing protein 3 i... 61 1e-07 ref|XP_014509806.1| OTU domain-containing protein 3 isoform X1 [... 61 1e-07 >gb|KYP44921.1| OTU domain-containing protein 3 [Cajanus cajan] Length = 305 Score = 72.8 bits (177), Expect = 5e-12 Identities = 39/51 (76%), Positives = 40/51 (78%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGISR------EFDSVTPDMGALCI 136 GKQSAKFAVNQAADSRR KERKQ KKGIS E+D VTPDMGALCI Sbjct: 255 GKQSAKFAVNQAADSRRGKKERKQGKKGISAKAEVPCEYDLVTPDMGALCI 305 >ref|XP_020237268.1| OTU domain-containing protein 3 isoform X1 [Cajanus cajan] ref|XP_020237269.1| OTU domain-containing protein 3 isoform X2 [Cajanus cajan] Length = 384 Score = 72.8 bits (177), Expect = 8e-12 Identities = 39/51 (76%), Positives = 40/51 (78%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGISR------EFDSVTPDMGALCI 136 GKQSAKFAVNQAADSRR KERKQ KKGIS E+D VTPDMGALCI Sbjct: 334 GKQSAKFAVNQAADSRRGKKERKQGKKGISAKAEVPCEYDLVTPDMGALCI 384 >ref|XP_006600943.1| PREDICTED: OTU domain-containing protein 3 isoform X3 [Glycine max] Length = 384 Score = 67.0 bits (162), Expect = 9e-10 Identities = 35/51 (68%), Positives = 39/51 (76%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGIS------REFDSVTPDMGALCI 136 GKQSAKF V+QAADS++ KERKQ KKGIS E+D VTPDMGALCI Sbjct: 334 GKQSAKFVVHQAADSKKGKKERKQGKKGISAKAEVPSEYDLVTPDMGALCI 384 >ref|XP_006600939.1| PREDICTED: OTU domain-containing protein 3 isoform X1 [Glycine max] ref|XP_006600941.1| PREDICTED: OTU domain-containing protein 3 isoform X1 [Glycine max] ref|XP_014625404.1| PREDICTED: OTU domain-containing protein 3 isoform X1 [Glycine max] gb|KRH04562.1| hypothetical protein GLYMA_17G170400 [Glycine max] Length = 387 Score = 67.0 bits (162), Expect = 9e-10 Identities = 35/51 (68%), Positives = 39/51 (76%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGIS------REFDSVTPDMGALCI 136 GKQSAKF V+QAADS++ KERKQ KKGIS E+D VTPDMGALCI Sbjct: 337 GKQSAKFVVHQAADSKKGKKERKQGKKGISAKAEVPSEYDLVTPDMGALCI 387 >ref|XP_013457429.1| OTU-like cysteine protease family protein [Medicago truncatula] gb|KEH31460.1| OTU-like cysteine protease family protein [Medicago truncatula] Length = 477 Score = 52.8 bits (125), Expect(2) = 2e-09 Identities = 28/46 (60%), Positives = 33/46 (71%), Gaps = 3/46 (6%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQ---EKKGISREFDSVTPDMGAL 130 GKQSAKF VNQAADSRR+ K+ K+ K G+S E+DSVTP L Sbjct: 338 GKQSAKFLVNQAADSRRNKKDTKKGISAKAGVSCEYDSVTPTFSLL 383 Score = 36.6 bits (83), Expect(2) = 2e-09 Identities = 22/38 (57%), Positives = 23/38 (60%) Frame = +3 Query: 156 KSILCSFGGENLLTGFLFAEAKFCTGKGYTKGEIMSQN 269 K ILCS LLT EAK TGKGYT+GEIM N Sbjct: 396 KKILCSPRRAKLLT-----EAKLQTGKGYTEGEIMMLN 428 >gb|PNY11745.1| OTU domain-containing protein 3-like [Trifolium pratense] Length = 480 Score = 64.7 bits (156), Expect = 6e-09 Identities = 45/82 (54%), Positives = 52/82 (63%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGISREFDSVTPDMGALCI*IDNNSEVNFVLFWR 181 GK +AKF VNQ ADSRRS K+E KG+S + + VTPDMGAL SEVNFVL R Sbjct: 354 GKNTAKFVVNQEADSRRS----KKETKGVSAKAE-VTPDMGAL-------SEVNFVLPKR 401 Query: 182 REPTDRFPFCRSKILHRERIYK 247 RE D RS + + ERIYK Sbjct: 402 RETND-----RSTMSNSERIYK 418 >ref|XP_013457431.1| OTU-like cysteine protease family protein [Medicago truncatula] gb|KEH31462.1| OTU-like cysteine protease family protein [Medicago truncatula] Length = 311 Score = 63.2 bits (152), Expect = 2e-08 Identities = 33/48 (68%), Positives = 38/48 (79%), Gaps = 3/48 (6%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQ---EKKGISREFDSVTPDMGALCI 136 GKQSAKF VNQAADSRR+ K+ K+ K G+S E+DSVT DMGALCI Sbjct: 264 GKQSAKFLVNQAADSRRNKKDTKKGISAKAGVSCEYDSVTRDMGALCI 311 >ref|XP_013457430.1| OTU-like cysteine protease family protein [Medicago truncatula] gb|KEH31461.1| OTU-like cysteine protease family protein [Medicago truncatula] Length = 384 Score = 63.2 bits (152), Expect = 2e-08 Identities = 33/48 (68%), Positives = 38/48 (79%), Gaps = 3/48 (6%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQ---EKKGISREFDSVTPDMGALCI 136 GKQSAKF VNQAADSRR+ K+ K+ K G+S E+DSVT DMGALCI Sbjct: 337 GKQSAKFLVNQAADSRRNKKDTKKGISAKAGVSCEYDSVTRDMGALCI 384 >ref|XP_016185369.1| OTU domain-containing protein 3 isoform X5 [Arachis ipaensis] Length = 329 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 6/50 (12%) Frame = +2 Query: 5 KQSAKFAVNQAADSRRSNKERKQEKKGISR------EFDSVTPDMGALCI 136 +QSA+F VNQAA+SRRS ++ KQ KKG+S ++DSVTPDMGALCI Sbjct: 280 RQSARFVVNQAAESRRSKRDSKQGKKGVSSKADVSGDYDSVTPDMGALCI 329 >ref|XP_016185362.1| OTU domain-containing protein 3 isoform X4 [Arachis ipaensis] ref|XP_020974404.1| OTU domain-containing protein 3 isoform X4 [Arachis ipaensis] Length = 340 Score = 62.8 bits (151), Expect = 2e-08 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 6/50 (12%) Frame = +2 Query: 5 KQSAKFAVNQAADSRRSNKERKQEKKGISR------EFDSVTPDMGALCI 136 +QSA+F VNQAA+SRRS ++ KQ KKG+S ++DSVTPDMGALCI Sbjct: 291 RQSARFVVNQAAESRRSKRDSKQGKKGVSSKADVSGDYDSVTPDMGALCI 340 >ref|XP_016185356.1| OTU domain-containing protein 3 isoform X3 [Arachis ipaensis] Length = 386 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 6/50 (12%) Frame = +2 Query: 5 KQSAKFAVNQAADSRRSNKERKQEKKGISR------EFDSVTPDMGALCI 136 +QSA+F VNQAA+SRRS ++ KQ KKG+S ++DSVTPDMGALCI Sbjct: 337 RQSARFVVNQAAESRRSKRDSKQGKKGVSSKADVSGDYDSVTPDMGALCI 386 >ref|XP_016185350.1| OTU domain-containing protein 3 isoform X2 [Arachis ipaensis] Length = 412 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 6/50 (12%) Frame = +2 Query: 5 KQSAKFAVNQAADSRRSNKERKQEKKGISR------EFDSVTPDMGALCI 136 +QSA+F VNQAA+SRRS ++ KQ KKG+S ++DSVTPDMGALCI Sbjct: 363 RQSARFVVNQAAESRRSKRDSKQGKKGVSSKADVSGDYDSVTPDMGALCI 412 >ref|XP_016185346.1| OTU domain-containing protein 3 isoform X1 [Arachis ipaensis] Length = 413 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 6/50 (12%) Frame = +2 Query: 5 KQSAKFAVNQAADSRRSNKERKQEKKGISR------EFDSVTPDMGALCI 136 +QSA+F VNQAA+SRRS ++ KQ KKG+S ++DSVTPDMGALCI Sbjct: 364 RQSARFVVNQAAESRRSKRDSKQGKKGVSSKADVSGDYDSVTPDMGALCI 413 >gb|KOM32346.1| hypothetical protein LR48_Vigan01g190200 [Vigna angularis] Length = 251 Score = 60.8 bits (146), Expect = 7e-08 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGIS------REFDSVTPDMGALCI 136 G QSAKF VNQAAD+RR ERK+ +KGIS E+D VTPD+GALCI Sbjct: 201 GTQSAKFLVNQAADARRGKNERKRGEKGISAKVEAPSEYDLVTPDVGALCI 251 >ref|XP_017410902.1| PREDICTED: OTU domain-containing protein 3 isoform X5 [Vigna angularis] Length = 335 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGIS------REFDSVTPDMGALCI 136 G QSAKF VNQAAD+RR ERK+ +KGIS E+D VTPD+GALCI Sbjct: 285 GTQSAKFLVNQAADARRGKNERKRGEKGISAKVEAPSEYDLVTPDVGALCI 335 >ref|XP_017410892.1| PREDICTED: OTU domain-containing protein 3 isoform X4 [Vigna angularis] Length = 371 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGIS------REFDSVTPDMGALCI 136 G QSAKF VNQAAD+RR ERK+ +KGIS E+D VTPD+GALCI Sbjct: 321 GTQSAKFLVNQAADARRGKNERKRGEKGISAKVEAPSEYDLVTPDVGALCI 371 >ref|XP_017410884.1| PREDICTED: OTU domain-containing protein 3 isoform X3 [Vigna angularis] Length = 381 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGIS------REFDSVTPDMGALCI 136 G QSAKF VNQAAD+RR ERK+ +KGIS E+D VTPD+GALCI Sbjct: 331 GTQSAKFLVNQAADARRGKNERKRGEKGISAKVEAPSEYDLVTPDVGALCI 381 >ref|XP_014509808.1| OTU domain-containing protein 3 isoform X2 [Vigna radiata var. radiata] Length = 381 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGIS------REFDSVTPDMGALCI 136 G QSAKF VNQAAD+RR ERK+ +KGIS E+D VTPD+GALCI Sbjct: 331 GTQSAKFLVNQAADARRGKNERKRGEKGISAKGEVPSEYDLVTPDVGALCI 381 >ref|XP_017410875.1| PREDICTED: OTU domain-containing protein 3 isoform X2 [Vigna angularis] Length = 382 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGIS------REFDSVTPDMGALCI 136 G QSAKF VNQAAD+RR ERK+ +KGIS E+D VTPD+GALCI Sbjct: 332 GTQSAKFLVNQAADARRGKNERKRGEKGISAKVEAPSEYDLVTPDVGALCI 382 >ref|XP_014509806.1| OTU domain-containing protein 3 isoform X1 [Vigna radiata var. radiata] ref|XP_014509807.1| OTU domain-containing protein 3 isoform X1 [Vigna radiata var. radiata] ref|XP_022639056.1| OTU domain-containing protein 3 isoform X1 [Vigna radiata var. radiata] ref|XP_022639057.1| OTU domain-containing protein 3 isoform X1 [Vigna radiata var. radiata] Length = 384 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 6/51 (11%) Frame = +2 Query: 2 GKQSAKFAVNQAADSRRSNKERKQEKKGIS------REFDSVTPDMGALCI 136 G QSAKF VNQAAD+RR ERK+ +KGIS E+D VTPD+GALCI Sbjct: 334 GTQSAKFLVNQAADARRGKNERKRGEKGISAKGEVPSEYDLVTPDVGALCI 384