BLASTX nr result
ID: Astragalus24_contig00027882
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00027882 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624026.1| PPR containing plant-like protein [Medicago ... 80 1e-14 ref|XP_004485903.1| PREDICTED: pentatricopeptide repeat-containi... 79 4e-14 ref|XP_006575401.1| PREDICTED: pentatricopeptide repeat-containi... 77 1e-13 ref|XP_014504253.2| pentatricopeptide repeat-containing protein ... 72 1e-11 gb|KRH16993.1| hypothetical protein GLYMA_14G190500 [Glycine max] 71 2e-11 ref|XP_017429631.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-11 ref|XP_020240560.1| pentatricopeptide repeat-containing protein ... 68 2e-10 ref|XP_007148596.1| hypothetical protein PHAVU_006G221900g [Phas... 67 4e-10 ref|XP_019425780.1| PREDICTED: pentatricopeptide repeat-containi... 62 3e-08 gb|PRQ19576.1| putative tetratricopeptide-like helical domain, D... 55 8e-06 ref|XP_024170183.1| pentatricopeptide repeat-containing protein ... 55 8e-06 >ref|XP_003624026.1| PPR containing plant-like protein [Medicago truncatula] gb|ABN08505.1| Tetratricopeptide-like helical [Medicago truncatula] gb|AES80244.1| PPR containing plant-like protein [Medicago truncatula] Length = 646 Score = 80.1 bits (196), Expect = 1e-14 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +1 Query: 298 MSPLNEKNIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 MSPLN +I+SKITNLHRLRQLHAQL++HSLHHQNHWV LLL+ Sbjct: 1 MSPLNNTSIVSKITNLHRLRQLHAQLVHHSLHHQNHWVVLLLT 43 >ref|XP_004485903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470-like [Cicer arietinum] Length = 613 Score = 78.6 bits (192), Expect = 4e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = +1 Query: 298 MSPLNEKNIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 MSPLN KNI++KITNLH LRQLHAQL++HSLHHQNHWV+ LL+ Sbjct: 1 MSPLNNKNIVNKITNLHCLRQLHAQLLHHSLHHQNHWVSFLLT 43 >ref|XP_006575401.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470 [Glycine max] ref|XP_014624649.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470 [Glycine max] gb|KRH72630.1| hypothetical protein GLYMA_02G223800 [Glycine max] Length = 640 Score = 77.0 bits (188), Expect = 1e-13 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = +1 Query: 298 MSPLNEKNIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 MSPLN+KNI SKITNLH LRQLHAQL+ HS HH NHWVALLL+ Sbjct: 1 MSPLNKKNIASKITNLHHLRQLHAQLVLHSQHHHNHWVALLLT 43 >ref|XP_014504253.2| pentatricopeptide repeat-containing protein At1g14470 [Vigna radiata var. radiata] Length = 650 Score = 71.6 bits (174), Expect = 1e-11 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = +1 Query: 283 QLRPGMSPLNEKNIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 QL GMSPL++ +II K+ NL +LRQLHAQL+ HS HH+NHWVALLL+ Sbjct: 8 QLHSGMSPLSKTSIIGKVANLDQLRQLHAQLVLHSQHHRNHWVALLLT 55 >gb|KRH16993.1| hypothetical protein GLYMA_14G190500 [Glycine max] Length = 521 Score = 70.9 bits (172), Expect = 2e-11 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +1 Query: 298 MSPLNEKNIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 MSPLN+K+I SKITNLH LRQLHAQL HS H NHWVALLL+ Sbjct: 1 MSPLNKKSIASKITNLHHLRQLHAQLFLHSQHRHNHWVALLLT 43 >ref|XP_017429631.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470 [Vigna angularis] gb|KOM47196.1| hypothetical protein LR48_Vigan07g090000 [Vigna angularis] Length = 637 Score = 70.1 bits (170), Expect = 3e-11 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +1 Query: 298 MSPLNEKNIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 MSPL++K+I K+ NLH+LRQLHAQL+ HS HH+NHWVALLL+ Sbjct: 1 MSPLSKKSITGKVANLHQLRQLHAQLVLHSQHHRNHWVALLLT 43 >ref|XP_020240560.1| pentatricopeptide repeat-containing protein At1g14470 [Cajanus cajan] Length = 638 Score = 67.8 bits (164), Expect = 2e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +1 Query: 298 MSPLNEKNIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 MSP N+K I SKITNLH L+QLHAQL+ HS HH N WVALLL+ Sbjct: 1 MSPWNKKTIASKITNLHHLKQLHAQLVLHSHHHHNRWVALLLT 43 >ref|XP_007148596.1| hypothetical protein PHAVU_006G221900g [Phaseolus vulgaris] gb|ESW20590.1| hypothetical protein PHAVU_006G221900g [Phaseolus vulgaris] Length = 638 Score = 67.0 bits (162), Expect = 4e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +1 Query: 298 MSPLNEKNIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 MS L +K+I KI NLH+LRQLHAQL+ HS HH+NHWVALLL+ Sbjct: 1 MSTLKKKSIAGKIANLHQLRQLHAQLVLHSQHHRNHWVALLLT 43 >ref|XP_019425780.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470 [Lupinus angustifolius] Length = 766 Score = 61.6 bits (148), Expect = 3e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 319 NIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 NI KI NLH LRQLHAQL++HSLHH NHWV LLL+ Sbjct: 7 NISRKIRNLHDLRQLHAQLVHHSLHHHNHWVVLLLN 42 >gb|PRQ19576.1| putative tetratricopeptide-like helical domain, DYW domain-containing protein [Rosa chinensis] Length = 729 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = +1 Query: 298 MSPLNEKNIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 MS L+ +++ KI+N+ +LRQLHA LI +SLHHQN WV+LL++ Sbjct: 1 MSVLHLDSLLCKISNVSQLRQLHAHLIQNSLHHQNQWVSLLIN 43 >ref|XP_024170183.1| pentatricopeptide repeat-containing protein At1g14470 [Rosa chinensis] Length = 764 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = +1 Query: 298 MSPLNEKNIISKITNLHRLRQLHAQLINHSLHHQNHWVALLLS 426 MS L+ +++ KI+N+ +LRQLHA LI +SLHHQN WV+LL++ Sbjct: 1 MSVLHLDSLLCKISNVSQLRQLHAHLIQNSLHHQNQWVSLLIN 43