BLASTX nr result
ID: Astragalus24_contig00027708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00027708 (520 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG04362.1| DEAD-box ATP-dependent RNA helicase 56 [Gossypium... 66 1e-09 gb|PPD71809.1| hypothetical protein GOBAR_DD31290 [Gossypium bar... 64 7e-09 >gb|KHG04362.1| DEAD-box ATP-dependent RNA helicase 56 [Gossypium arboreum] Length = 301 Score = 65.9 bits (159), Expect = 1e-09 Identities = 34/52 (65%), Positives = 38/52 (73%) Frame = -1 Query: 157 LQGDNTDGQELRFNGSSASGIHFILDSISLRKDPNIIYCQICSFQPMEIYVD 2 LQG +DG E + AS IHF+LDSI LRK N+IYC ICSFQPMEIYVD Sbjct: 3 LQGGKSDGPESQIK-RCASIIHFVLDSIFLRKLANMIYCHICSFQPMEIYVD 53 >gb|PPD71809.1| hypothetical protein GOBAR_DD31290 [Gossypium barbadense] Length = 391 Score = 64.3 bits (155), Expect = 7e-09 Identities = 36/55 (65%), Positives = 40/55 (72%) Frame = -1 Query: 166 KKFLQGDNTDGQELRFNGSSASGIHFILDSISLRKDPNIIYCQICSFQPMEIYVD 2 KKF+Q N G E +F SAS IHF LDSI L+K PN+IYC I SFQPMEIYVD Sbjct: 158 KKFMQDAN--GLESQFK-RSASKIHFALDSICLKKLPNMIYCDISSFQPMEIYVD 209