BLASTX nr result
ID: Astragalus24_contig00027684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00027684 (555 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX74693.1| MORN repeat-containing protein 1-like [Trifolium ... 64 1e-08 ref|XP_004488906.1| PREDICTED: MORN repeat-containing protein 1-... 63 3e-08 dbj|GAU50261.1| hypothetical protein TSUD_409070 [Trifolium subt... 62 8e-08 >gb|PNX74693.1| MORN repeat-containing protein 1-like [Trifolium pratense] Length = 418 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +3 Query: 366 MEAQKKKSQSKLTRTKSSLLRCSSPTTRSSIPSLSSV 476 ME QK KSQ+KLTRTKSSLLRCSSPT RSSIPSL SV Sbjct: 1 METQKNKSQTKLTRTKSSLLRCSSPTNRSSIPSLGSV 37 >ref|XP_004488906.1| PREDICTED: MORN repeat-containing protein 1-like [Cicer arietinum] Length = 426 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +3 Query: 366 MEAQKKKSQSKLTRTKSSLLRCSSPTTRSSIPSLSSV 476 ME K KSQ KLTRTKSSLLRCSSPTTRSSIPSL S+ Sbjct: 1 METPKNKSQGKLTRTKSSLLRCSSPTTRSSIPSLGSI 37 >dbj|GAU50261.1| hypothetical protein TSUD_409070 [Trifolium subterraneum] Length = 442 Score = 61.6 bits (148), Expect = 8e-08 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +3 Query: 366 MEAQKKKSQSKLTRTKSSLLRCSSPTTRSSIPSLSSV 476 ME K KSQ+KLTRTKSSLLRCSSPT RSSIPSL SV Sbjct: 1 METPKNKSQTKLTRTKSSLLRCSSPTNRSSIPSLGSV 37