BLASTX nr result
ID: Astragalus24_contig00027591
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00027591 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU26304.1| hypothetical protein TSUD_56020 [Trifolium subte... 82 2e-17 gb|KYP72214.1| Putative AC transposase [Cajanus cajan] 79 1e-16 dbj|GAU10851.1| hypothetical protein TSUD_424540, partial [Trifo... 80 2e-16 dbj|GAU32675.1| hypothetical protein TSUD_218520 [Trifolium subt... 79 3e-16 ref|XP_012438651.1| PREDICTED: uncharacterized protein LOC105764... 80 3e-16 ref|XP_012465932.1| PREDICTED: zinc finger BED domain-containing... 79 3e-16 gb|KYP46557.1| Putative AC transposase [Cajanus cajan] 84 5e-16 ref|XP_012465931.1| PREDICTED: zinc finger BED domain-containing... 79 5e-16 gb|KYP74284.1| Putative AC transposase [Cajanus cajan] 84 5e-16 ref|XP_020231449.1| zinc finger BED domain-containing protein RI... 84 5e-16 ref|XP_008804919.1| PREDICTED: zinc finger BED domain-containing... 79 5e-16 ref|XP_011081417.1| zinc finger BED domain-containing protein RI... 82 7e-16 dbj|GAU25736.1| hypothetical protein TSUD_216670 [Trifolium subt... 79 1e-15 ref|XP_022894049.1| zinc finger BED domain-containing protein RI... 82 2e-15 ref|XP_022882494.1| zinc finger BED domain-containing protein RI... 82 2e-15 dbj|GAU31155.1| hypothetical protein TSUD_315800 [Trifolium subt... 76 2e-15 ref|XP_012438141.1| PREDICTED: zinc finger BED domain-containing... 80 2e-15 gb|PNX81240.1| HAT family dimerization domain-containing protein... 77 2e-15 ref|XP_020982398.1| zinc finger BED domain-containing protein RI... 79 3e-15 ref|XP_020966946.1| EKC/KEOPS complex subunit BUD32-like [Arachi... 79 3e-15 >dbj|GAU26304.1| hypothetical protein TSUD_56020 [Trifolium subterraneum] Length = 115 Score = 82.0 bits (201), Expect = 2e-17 Identities = 40/56 (71%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = +3 Query: 201 AREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDWF-GSHSPMLT 365 AR++LAIP++TVASESAFSTG VLDPYR LTPTT EALICTQDW G+ S ++T Sbjct: 23 ARDVLAIPITTVASESAFSTGERVLDPYRSSLTPTTTEALICTQDWLKGTSSSLIT 78 >gb|KYP72214.1| Putative AC transposase [Cajanus cajan] Length = 72 Score = 78.6 bits (192), Expect = 1e-16 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = +3 Query: 201 AREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 AR++LAIPVSTVASE AFSTGG VLDPYR LTP VEALICTQDW Sbjct: 2 ARDLLAIPVSTVASEFAFSTGGRVLDPYRSSLTPRMVEALICTQDW 47 >dbj|GAU10851.1| hypothetical protein TSUD_424540, partial [Trifolium subterraneum] Length = 120 Score = 79.7 bits (195), Expect = 2e-16 Identities = 41/56 (73%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = +3 Query: 201 AREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDWF-GSHSPMLT 365 AR++LAIPVSTVASESAFSTGG VLD YR RL+ TVEALICT+DW GS +P+ T Sbjct: 33 ARDLLAIPVSTVASESAFSTGGRVLDEYRSRLSTRTVEALICTEDWLGGSPTPLPT 88 >dbj|GAU32675.1| hypothetical protein TSUD_218520 [Trifolium subterraneum] Length = 120 Score = 79.3 bits (194), Expect = 3e-16 Identities = 41/56 (73%), Positives = 47/56 (83%), Gaps = 1/56 (1%) Frame = +3 Query: 201 AREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDWF-GSHSPMLT 365 AR++LAIPVSTVASESAFSTGG VLD YR RL+ TVEALICT+DW GS +P+ T Sbjct: 33 ARDLLAIPVSTVASESAFSTGGRVLDEYRSRLSTRTVEALICTKDWLGGSPTPLPT 88 >ref|XP_012438651.1| PREDICTED: uncharacterized protein LOC105764568 isoform X3 [Gossypium raimondii] Length = 144 Score = 79.7 bits (195), Expect = 3e-16 Identities = 38/54 (70%), Positives = 43/54 (79%) Frame = +3 Query: 192 SKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDWFGSHS 353 SK AR++LAIPVSTVASESAFSTGG VLD YR LTP ++AL+CTQDW S Sbjct: 52 SKIARDVLAIPVSTVASESAFSTGGRVLDQYRSSLTPKIIQALVCTQDWIRKSS 105 >ref|XP_012465932.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X2 [Gossypium raimondii] Length = 131 Score = 79.3 bits (194), Expect = 3e-16 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +3 Query: 192 SKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 SK AR++LAIP+STVASESAFSTGG VLD YR LTP V+AL+CTQDW Sbjct: 57 SKMARDVLAIPISTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDW 105 >gb|KYP46557.1| Putative AC transposase [Cajanus cajan] Length = 558 Score = 84.0 bits (206), Expect = 5e-16 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = +3 Query: 192 SKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 SK AR++LAIPVSTVASESAFSTGG VLDPYR LTP VEALICTQDW Sbjct: 467 SKMARDLLAIPVSTVASESAFSTGGRVLDPYRSSLTPRMVEALICTQDW 515 >ref|XP_012465931.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like isoform X1 [Gossypium raimondii] Length = 143 Score = 79.3 bits (194), Expect = 5e-16 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +3 Query: 192 SKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 SK AR++LAIP+STVASESAFSTGG VLD YR LTP V+AL+CTQDW Sbjct: 57 SKMARDVLAIPISTVASESAFSTGGRVLDQYRSSLTPKIVQALVCTQDW 105 >gb|KYP74284.1| Putative AC transposase [Cajanus cajan] Length = 657 Score = 84.0 bits (206), Expect = 5e-16 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = +3 Query: 192 SKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 SK AR++LAIPVSTVASESAFSTGG VLDPYR LTP VEALICTQDW Sbjct: 566 SKMARDLLAIPVSTVASESAFSTGGRVLDPYRSSLTPRMVEALICTQDW 614 >ref|XP_020231449.1| zinc finger BED domain-containing protein RICESLEEPER 2-like [Cajanus cajan] Length = 753 Score = 84.0 bits (206), Expect = 5e-16 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = +3 Query: 192 SKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 SK AR++LAIPVSTVASESAFSTGG VLDPYR LTP VEALICTQDW Sbjct: 585 SKMARDLLAIPVSTVASESAFSTGGRVLDPYRSSLTPRMVEALICTQDW 633 >ref|XP_008804919.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Phoenix dactylifera] Length = 134 Score = 79.0 bits (193), Expect = 5e-16 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = +3 Query: 192 SKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 S+ AR++LAIPVSTV+SESAFSTGG V+D YR L+P+TVEAL+CTQDW Sbjct: 54 SRMARDVLAIPVSTVSSESAFSTGGRVVDQYRSSLSPSTVEALVCTQDW 102 >ref|XP_011081417.1| zinc finger BED domain-containing protein RICESLEEPER 1-like [Sesamum indicum] Length = 301 Score = 82.0 bits (201), Expect = 7e-16 Identities = 50/123 (40%), Positives = 63/123 (51%), Gaps = 8/123 (6%) Frame = +3 Query: 9 KFDQEETRRAMVDYFVDCELPFRHVEKKKFXXXXXXXXXXXXXXFAHYCRMRYFETL--- 179 +FDQ+ TR A+ V ELPF+ VE +F F+ Sbjct: 152 RFDQDNTREALCHMLVVDELPFKLVEHPEFRHFLSVACLRFAIPSRRTITKDIFKIYVSE 211 Query: 180 -----RY*KSKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDWFG 344 + K A ++LA+PVSTVASESAFSTGG VLD +R L+P V+ALICTQDW Sbjct: 212 RARLKSFIKDHAQWDVLAVPVSTVASESAFSTGGRVLDTFRSSLSPKIVQALICTQDWIR 271 Query: 345 SHS 353 S Sbjct: 272 KDS 274 >dbj|GAU25736.1| hypothetical protein TSUD_216670 [Trifolium subterraneum] Length = 166 Score = 79.0 bits (193), Expect = 1e-15 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +3 Query: 192 SKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 ++ +RE+LAIPVSTVASESAFSTGG VLD YR L+ TTVEALICTQDW Sbjct: 75 ARISREVLAIPVSTVASESAFSTGGRVLDAYRSSLSSTTVEALICTQDW 123 >ref|XP_022894049.1| zinc finger BED domain-containing protein RICESLEEPER 2-like [Olea europaea var. sylvestris] Length = 534 Score = 82.4 bits (202), Expect = 2e-15 Identities = 39/57 (68%), Positives = 46/57 (80%) Frame = +3 Query: 192 SKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDWFGSHSPML 362 S+ AR++L IPVSTVASESAFSTGG +LDP+R LTP TVEALICTQ+W S +L Sbjct: 370 SEVARDVLVIPVSTVASESAFSTGGRILDPFRSSLTPKTVEALICTQNWLREESRLL 426 >ref|XP_022882494.1| zinc finger BED domain-containing protein RICESLEEPER 2-like [Olea europaea var. sylvestris] Length = 678 Score = 82.4 bits (202), Expect = 2e-15 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +3 Query: 195 KAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDWFGSHSPML 362 + AR++LAIPVSTVASESAFSTGG +LDP+R LTP TVEALICTQ+W S +L Sbjct: 591 EVARDVLAIPVSTVASESAFSTGGRILDPFRSSLTPKTVEALICTQNWLREESRLL 646 >dbj|GAU31155.1| hypothetical protein TSUD_315800 [Trifolium subterraneum] Length = 86 Score = 76.3 bits (186), Expect = 2e-15 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 1/56 (1%) Frame = +3 Query: 201 AREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDWF-GSHSPMLT 365 AR++LAIPVSTVASESAFSTGG VLD Y RL+ TVEALICT+DW GS +P+ T Sbjct: 14 ARDLLAIPVSTVASESAFSTGGRVLDEYCSRLSTRTVEALICTKDWLGGSPTPLPT 69 >ref|XP_012438141.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like [Gossypium raimondii] Length = 243 Score = 80.1 bits (196), Expect = 2e-15 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = +3 Query: 192 SKAAREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 SK AR++LAIPVSTVASESAFSTGG VLD YR LTP V+AL+CTQDW Sbjct: 151 SKTARDVLAIPVSTVASESAFSTGGHVLDQYRSSLTPKIVQALVCTQDW 199 >gb|PNX81240.1| HAT family dimerization domain-containing protein [Trifolium pratense] Length = 102 Score = 76.6 bits (187), Expect = 2e-15 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +3 Query: 201 AREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 ARE+LAIPVSTVASESAFS GG VLDP+R LTP VE L+CTQDW Sbjct: 34 AREVLAIPVSTVASESAFSAGGRVLDPHRSXLTPKIVEVLVCTQDW 79 >ref|XP_020982398.1| zinc finger BED domain-containing protein RICESLEEPER 2-like [Arachis duranensis] Length = 237 Score = 79.3 bits (194), Expect = 3e-15 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = +3 Query: 201 AREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 ARE+LAIPVSTVASESAFSTGG VLDPYR LTP VEAL+CT DW Sbjct: 149 AREVLAIPVSTVASESAFSTGGRVLDPYRSSLTPRMVEALVCTGDW 194 >ref|XP_020966946.1| EKC/KEOPS complex subunit BUD32-like [Arachis ipaensis] Length = 218 Score = 79.0 bits (193), Expect = 3e-15 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +3 Query: 201 AREILAIPVSTVASESAFSTGGSVLDPYRCRLTPTTVEALICTQDW 338 ARE+LAIPVSTVASESAFSTGG ++DPY+ LTP VEAL+CTQDW Sbjct: 2 AREVLAIPVSTVASESAFSTGGRIIDPYQSSLTPYMVEALVCTQDW 47