BLASTX nr result
ID: Astragalus24_contig00027524
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00027524 (321 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY14931.1| hypothetical protein L195_g011620 [Trifolium prat... 60 9e-09 dbj|GAU42538.1| hypothetical protein TSUD_341640 [Trifolium subt... 54 2e-07 dbj|GAU42537.1| hypothetical protein TSUD_341630 [Trifolium subt... 54 1e-06 >gb|PNY14931.1| hypothetical protein L195_g011620 [Trifolium pratense] Length = 161 Score = 59.7 bits (143), Expect = 9e-09 Identities = 33/43 (76%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +1 Query: 187 MRCSLGCIGSAAVNSDVQFLQACCNKEISLG-IRQVSKAKPKP 312 MRCSLG I S A NSDVQFLQA CNKEISL I QVSK KP P Sbjct: 1 MRCSLGWIASPAFNSDVQFLQASCNKEISLRLIIQVSKVKPYP 43 >dbj|GAU42538.1| hypothetical protein TSUD_341640 [Trifolium subterraneum] Length = 87 Score = 54.3 bits (129), Expect = 2e-07 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = +1 Query: 187 MRCSLGCIGSAAVNSDVQFLQACCNKEISLG-IRQVSKAKPKP 312 MRCSL I S A+NSDVQFLQA CNKEISL I QVSK K P Sbjct: 1 MRCSLRWIASPAINSDVQFLQASCNKEISLRLIIQVSKVKLYP 43 >dbj|GAU42537.1| hypothetical protein TSUD_341630 [Trifolium subterraneum] Length = 163 Score = 54.3 bits (129), Expect = 1e-06 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = +1 Query: 187 MRCSLGCIGSAAVNSDVQFLQACCNKEISLG-IRQVSKAKPKP 312 MRCSL I S A+NSDVQFLQA CNKEISL I QVSK K P Sbjct: 1 MRCSLRWIASPAINSDVQFLQASCNKEISLRLIIQVSKVKLYP 43