BLASTX nr result
ID: Astragalus24_contig00027472
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00027472 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013467750.1| adenine nucleotide alpha hydrolase superfami... 53 8e-06 >ref|XP_013467750.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago truncatula] gb|KEH41787.1| adenine nucleotide alpha hydrolase superfamily protein [Medicago truncatula] Length = 190 Score = 52.8 bits (125), Expect = 8e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +1 Query: 148 NGDPRELICQAVEQMQIDLLVMDSCGPGMLKR*KVGA 258 NGDPRE+ICQA EQMQ+DLL+M S G G LKR +G+ Sbjct: 128 NGDPREMICQASEQMQVDLLIMGSRGLGTLKRAFLGS 164