BLASTX nr result
ID: Astragalus24_contig00027246
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00027246 (604 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007142978.1| hypothetical protein PHAVU_007G033400g [Phas... 53 4e-06 >ref|XP_007142978.1| hypothetical protein PHAVU_007G033400g [Phaseolus vulgaris] gb|ESW14972.1| hypothetical protein PHAVU_007G033400g [Phaseolus vulgaris] Length = 59 Score = 52.8 bits (125), Expect = 4e-06 Identities = 33/57 (57%), Positives = 36/57 (63%), Gaps = 3/57 (5%) Frame = +1 Query: 343 KLGRV*LQSLFCVA---SFTISINPYLLKSPSTLHSRRIRRGKHPLPPLPELSKTQS 504 KLGRV LQS FCV SF IS YL K PS LH R +RR +H PP E+ KTQS Sbjct: 4 KLGRVQLQS-FCVVLFPSFIISFCAYLRKCPSALHHRGLRRSEHLSPPHLEVRKTQS 59