BLASTX nr result
ID: Astragalus24_contig00027201
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00027201 (341 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN36177.1| hypothetical protein glysoja_003300 [Glycine soja] 52 1e-06 gb|KRH76913.1| hypothetical protein GLYMA_01G181000 [Glycine max] 52 2e-06 >gb|KHN36177.1| hypothetical protein glysoja_003300 [Glycine soja] Length = 71 Score = 52.4 bits (124), Expect = 1e-06 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = +1 Query: 97 EDKSRHLSERIPLFLPSIPDLSFNFLIVNCFVEFQFFRVFDSWHGDD 237 +DKSRHLSERIPLFLPS FNFL V C + +F F++ HGDD Sbjct: 9 DDKSRHLSERIPLFLPSFIFGLFNFLRVVCCFDCLYF--FETRHGDD 53 >gb|KRH76913.1| hypothetical protein GLYMA_01G181000 [Glycine max] Length = 74 Score = 51.6 bits (122), Expect = 2e-06 Identities = 29/48 (60%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +1 Query: 97 EDKSRHLSERIPLFLPSIPDLSFNFL-IVNCFVEFQFFRVFDSWHGDD 237 +DKSRHLSERIPLFLPS FNFL +V CF F F+ HGDD Sbjct: 9 DDKSRHLSERIPLFLPSFIFGLFNFLRMVCCFDCLYFLCFFEIRHGDD 56