BLASTX nr result
ID: Astragalus24_contig00027173
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00027173 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU25619.1| hypothetical protein TSUD_49710 [Trifolium subte... 58 8e-07 gb|PNX96679.1| CONSTANS-like zinc finger protein [Trifolium prat... 58 9e-07 ref|XP_017413213.1| PREDICTED: putative zinc finger protein At1g... 58 1e-06 gb|KYP75152.1| Putative zinc finger protein At1g68190 family [Ca... 55 1e-06 ref|XP_013470128.1| B-box zinc finger protein, putative [Medicag... 57 1e-06 ref|XP_004497022.1| PREDICTED: putative zinc finger protein At1g... 55 5e-06 ref|XP_020224394.1| putative zinc finger protein At1g68190 isofo... 55 6e-06 ref|XP_020224372.1| putative zinc finger protein At1g68190 isofo... 55 6e-06 gb|KHN42419.1| Putative zinc finger protein [Glycine soja] 55 6e-06 ref|XP_003555259.1| PREDICTED: putative zinc finger protein At1g... 55 6e-06 ref|XP_003535713.1| PREDICTED: putative zinc finger protein At1g... 55 6e-06 gb|EEF36085.1| zinc finger protein, putative [Ricinus communis] 54 7e-06 >dbj|GAU25619.1| hypothetical protein TSUD_49710 [Trifolium subterraneum] Length = 320 Score = 57.8 bits (138), Expect = 8e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEKVCEFCTAL PLVYCN DAAYLCLS Sbjct: 1 MEKVCEFCTALRPLVYCNADAAYLCLS 27 >gb|PNX96679.1| CONSTANS-like zinc finger protein [Trifolium pratense] Length = 349 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEKVCEFCTAL PLVYCN DAAYLCLS Sbjct: 1 MEKVCEFCTALRPLVYCNADAAYLCLS 27 >ref|XP_017413213.1| PREDICTED: putative zinc finger protein At1g68190 [Vigna angularis] Length = 488 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 378 LTTKEMEKVCEFCTALSPLVYCNPDAAYLCLS 473 L KEM+KVCEFCTAL PLVYC D+AYLCLS Sbjct: 34 LKIKEMDKVCEFCTALRPLVYCKADSAYLCLS 65 >gb|KYP75152.1| Putative zinc finger protein At1g68190 family [Cajanus cajan] Length = 147 Score = 55.5 bits (132), Expect = 1e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEKVCEFCTAL PLVYC DAAYLCLS Sbjct: 1 MEKVCEFCTALRPLVYCKADAAYLCLS 27 >ref|XP_013470128.1| B-box zinc finger protein, putative [Medicago truncatula] gb|KEH44166.1| B-box zinc finger protein, putative [Medicago truncatula] Length = 344 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEK+CEFCTAL PLVYCN DAAYLCLS Sbjct: 1 MEKICEFCTALRPLVYCNADAAYLCLS 27 >ref|XP_004497022.1| PREDICTED: putative zinc finger protein At1g68190 [Cicer arietinum] Length = 340 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEKVCEFC AL PLVYCN DAAYLCLS Sbjct: 1 MEKVCEFCKALRPLVYCNADAAYLCLS 27 >ref|XP_020224394.1| putative zinc finger protein At1g68190 isoform X2 [Cajanus cajan] Length = 376 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEKVCEFCTAL PLVYC DAAYLCLS Sbjct: 1 MEKVCEFCTALRPLVYCKADAAYLCLS 27 >ref|XP_020224372.1| putative zinc finger protein At1g68190 isoform X1 [Cajanus cajan] ref|XP_020224379.1| putative zinc finger protein At1g68190 isoform X1 [Cajanus cajan] ref|XP_020224387.1| putative zinc finger protein At1g68190 isoform X1 [Cajanus cajan] gb|KYP75116.1| Putative zinc finger protein At1g68190 family [Cajanus cajan] Length = 428 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEKVCEFCTAL PLVYC DAAYLCLS Sbjct: 1 MEKVCEFCTALRPLVYCKADAAYLCLS 27 >gb|KHN42419.1| Putative zinc finger protein [Glycine soja] Length = 438 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEKVCEFCTAL PLVYC DAAYLCLS Sbjct: 1 MEKVCEFCTALRPLVYCKADAAYLCLS 27 >ref|XP_003555259.1| PREDICTED: putative zinc finger protein At1g68190 [Glycine max] gb|KRG90917.1| hypothetical protein GLYMA_20G121700 [Glycine max] Length = 438 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEKVCEFCTAL PLVYC DAAYLCLS Sbjct: 1 MEKVCEFCTALRPLVYCKADAAYLCLS 27 >ref|XP_003535713.1| PREDICTED: putative zinc finger protein At1g68190 [Glycine max] ref|XP_006589664.1| PREDICTED: putative zinc finger protein At1g68190 [Glycine max] gb|KHN06706.1| Putative zinc finger protein [Glycine soja] gb|KRH35868.1| hypothetical protein GLYMA_10G269400 [Glycine max] gb|KRH35869.1| hypothetical protein GLYMA_10G269400 [Glycine max] Length = 438 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEKVCEFCTAL PLVYC DAAYLCLS Sbjct: 1 MEKVCEFCTALRPLVYCKADAAYLCLS 27 >gb|EEF36085.1| zinc finger protein, putative [Ricinus communis] Length = 178 Score = 53.9 bits (128), Expect = 7e-06 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 Query: 393 MEKVCEFCTALSPLVYCNPDAAYLCLS 473 MEK+CEFCTAL P++YC DAAYLCLS Sbjct: 1 MEKICEFCTALRPIIYCKADAAYLCLS 27