BLASTX nr result
ID: Astragalus24_contig00027162
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus24_contig00027162 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU43934.1| hypothetical protein TSUD_135820 [Trifolium subt... 64 1e-08 >dbj|GAU43934.1| hypothetical protein TSUD_135820 [Trifolium subterraneum] Length = 713 Score = 63.9 bits (154), Expect = 1e-08 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 2/91 (2%) Frame = -2 Query: 350 MQNEATFKRNMNSQERDQRSTSNIDLGHYRSSHELLRVFKIKCEQVLKNIGGSNAPMTEV 171 M+NE K+NM + QR S+ +L RSS EL + ++IK E+ + N+ NA +V Sbjct: 1 MKNEINNKKNMKCHVKSQRGASSFELPQVRSSAELAKRYQIKREEGMANLRQKNASTAKV 60 Query: 170 ESACNKQKKPPTTK--EVSSQAIKVTKQFNS 84 E CNKQ +PPT+K ++S A NS Sbjct: 61 EGPCNKQNQPPTSKPFKLSMFATNTNTNMNS 91